Anti-Aquaporin 2

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG40567.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Forms a water-specific channel that provides the plasma membranes of renal... more

Close menu

Product information "Anti-Aquaporin 2"

Protein function: Forms a water-specific channel that provides the plasma membranes of renal collecting duct with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient. [The UniProt Consortium]

Keywords:	Anti-AQP2, Anti-AQP-2, Anti-WCH-CD, Anti-AQP-CD, Anti-Aquaporin-2, Anti-Aquaporin-CD, Anti-ADH water channel, Anti-Collecting duct water channel protein, Anti-Water channel protein for renal collecting duct
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG40567

Properties

Application:	FC, IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat (Expected: hamster)
Immunogen:	Synthetic peptide corresponding to aa. 241-271 of Human Aquaporin 2. (EPDTDWEEREVRRRQSVELHSPQSLPRGTKA)
MW:	29 kD
Format:	Antigen Affinity Purified