Anti-APH1A

Anti-APH1A
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32302 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. APH1A encodes a component of the gamma... more
Product information "Anti-APH1A"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. APH1A encodes a component of the gamma secretase complex that cleaves integral membrane proteins such as Notch receptors and beta-amyloid precursor protein. The gamma secretase complex contains this gene product, or the paralogous anterior pharynx defective 1 homolog B (APH1B), along with the presenilin, nicastrin, and presenilin enhancer-2 proteins. The precise function of this seven-transmembrane-domain protein is unknown though it is suspected of facilitating the association of nicastrin and presenilin in the gamma secretase complex as well as interacting with substrates of the gamma secretase complex prior to their proteolytic processing. Polymorphisms in a promoter region of this gene have been associated with an increased risk for developing sporadic Alzheimer's disease. Alternative splicing results in multiple protein-coding and non-protein-coding transcript variants. Protein function: Essential subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral proteins such as Notch receptors and APP (beta-amyloid precursor protein). It probably represents a stabilizing cofactor for the presenilin homodimer that promotes the formation of a stable complex. [The UniProt Consortium]
Keywords: Anti-PSF, Anti-APH1A, Anti-CGI-78, Anti-APH-1a, Anti-Aph-1alpha, Anti-Gamma-secretase subunit APH-1A, Anti-Presenilin-stabilization factor, APH1A Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32302

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse
Immunogen: Amino acids LRSIQRSLLCRRQEDSRVMVYSALRIPPED of human APH1A were used as the immunogen for the APH1A antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-APH1A"
Write a review
or to review a product.
Viewed