Anti-ACVR1B (Activin Receptor Type-1B, Activin Receptor Type IB, Serine/Threonine-protein Kinase Rec

Anti-ACVR1B (Activin Receptor Type-1B, Activin Receptor Type IB, Serine/Threonine-protein Kinase Rec
Item number Size Datasheet Manual SDS Delivery time Quantity Price
122946.100 100 µg - -

3 - 19 business days*

699.00€
 
Activins are dimeric growth and differentiation factors which belong to the transforming growth... more
Product information "Anti-ACVR1B (Activin Receptor Type-1B, Activin Receptor Type IB, Serine/Threonine-protein Kinase Rec"
Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with a cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling, and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. The gene for ACVR1B (activin A type IB receptor) is composed of 11 exons. Alternative splicing and alternative polyadenylation result in 3 fully described transcript variants. The mRNA expression of variants 1, 2, and 3 is confirmed, and a potential fourth variant contains an alternative exon 8 and lacks exons 9 through 11, but its mRNA expression has not been confirmed. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 122946

Properties

Application: ELISA, WB
Antibody Type: Monoclonal
Clone: 1C1
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: Partial recombinant corresponding to aa24-126 from human ACVR1B (AAH00254) with GST tag. MW of the GST tag alone is 26kD.
Purity: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ACVR1B (Activin Receptor Type-1B, Activin Receptor Type IB, Serine/Threonine-protein Kinase Rec"
Write a review
or to review a product.
Viewed