33378 from 36884 pages
No results were found for the filter!
Anti-IFI16 (Interferon gamma-inducible Protein 16, Gamma-interferon-inducible Protein 16, Ifi-16, IF
Anti-IFI16 (Interferon gamma-inducible Protein 16,...

Item number: 128227.100

This gene encodes a member of the HIN-200 (hematopoietic interferon-inducible nuclear antigens with 200 amino acid repeats) family of cytokines. The encoded protein contains domains involved in DNA binding, transcriptional regulation, and protein-protein interactions. The protein localizes to the nucleoplasm and...
Application: ELISA, IF, IHC, WB
Reactivity: Human
528.00€ *
Review
Anti-IFI27 (Interferon alpha-inducible Protein 27, Mitochondrial, p27, Interferon alpha-induced 11.5
Anti-IFI27 (Interferon alpha-inducible Protein 27,...

Item number: 128228.100

Treatment of breast carcinoma MCF7 cells with estradiol led to induction of a new 27kD protein, the cDNA was later cloned and identified as p27. This highly hydrophobic protein of 122aa has 33% overall sequence similarity to the product of the 6-16 gene, that is induced by alfa/beta type interferons. It has been...
Application: WB
Reactivity: Human
564.00€ *
Review
Anti-IFI30 (Gamma-interferon-inducible Lysosomal Thiol Reductase, Gamma-interferon-inducible Protein
Anti-IFI30 (Gamma-interferon-inducible Lysosomal Thiol...

Item number: 128231.100

Lysosomal thiol reductase that can reduce protein disulfide bonds. May facilitate the complete unfolding of proteins destined for lysosomal degradation. Plays an important role in antigen processing. Facilitates the generation of MHC class II-restricted epitodes from disulfide bond-containing antigen by the...
Application: IP, WB
Reactivity: Human
564.00€ *
Review
Anti-IFI35 (FLJ21753, Interferon-induced 35 kDa Protein, IFP 35, Ifi-35, IFP35)
Anti-IFI35 (FLJ21753, Interferon-induced 35 kDa Protein,...

Item number: 128235.100

Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid...
Application: ELISA, WB
Reactivity: Human
528.00€ *
Review
Anti-IFI6 (Interferon alpha-inducible Protein 6, Interferon-induced Protein 6-16, Ifi-6-16, G1P3)
Anti-IFI6 (Interferon alpha-inducible Protein 6,...

Item number: 128238.100

Applications:, Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MRQKAVSLFLCYLLLFTCSGVEAGKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE, Storage and Stability:...
Application: ELISA
Reactivity: Human
528.00€ *
Review
Anti-MDA5 (Melanoma Differentiation-associated Protein 5, MDA-5, Interferon-induced Helicase C Domai
Anti-MDA5 (Melanoma Differentiation-associated Protein 5,...

Item number: 128239.50

The innate immune system detects viral infection by recognizing various viral components and triggers antiviral responses . Like the toll-like receptor 3 (TLR3), the melanoma differentiation-associated protein 5 (MDA5) recognizes double-stranded (ds) RNA, a molecular pattern associated with viral infection. MDA5, a...
Application: WB
Reactivity: Human
528.00€ *
Review
Anti-MDA5 (Melanoma Differentiation-associated Protein 5, MDA-5, Interferon-induced Helicase C Domai
Anti-MDA5 (Melanoma Differentiation-associated Protein 5,...

Item number: 128240-AP.100

The innate immune system detects viral infection by recognizing various viral components and triggers antiviral responses . Like the toll-like receptor 3 (TLR3), the melanoma differentiation-associated protein 5 (MDA5) recognizes double-stranded (ds) RNA, a molecular pattern associated with viral infection. MDA5, a...
Application: ELISA, IHC
Reactivity: Human
666.00€ *
Review
Anti-MDA5 (Melanoma Differentiation-associated Protein 5, MDA-5, Interferon-induced Helicase C Domai
Anti-MDA5 (Melanoma Differentiation-associated Protein 5,...

Item number: 128242.100

The innate immune system detects viral infection by recognizing various viral components and triggers antiviral responses . Like the toll-like receptor 3 (TLR3), the melanoma differentiation-associated protein 5 (MDA5) recognizes double-stranded (ds) RNA, a molecular pattern associated with viral infection. MDA5, a...
Application: WB
Reactivity: Human
564.00€ *
Review
Anti-MDA5 (Melanoma Differentiation-associated Protein 5, MDA-5, Interferon-induced Helicase C Domai
Anti-MDA5 (Melanoma Differentiation-associated Protein 5,...

Item number: 128242-AP.100

The innate immune system detects viral infection by recognizing various viral components and triggers antiviral responses . Like the toll-like receptor 3 (TLR3), the melanoma differentiation-associated protein 5 (MDA5) recognizes double-stranded (ds) RNA, a molecular pattern associated with viral infection. MDA5, a...
Application: WB
Reactivity: Human
703.00€ *
Review
Anti-IFIT1 (Interferon-induced Protein with Tetratricopeptide Repeats 1, IFIT-1, Interferon-induced
Anti-IFIT1 (Interferon-induced Protein with...

Item number: 128243.50

Interferon-induced antiviral RNA-binding protein that specifically binds single-stranded RNA bearing a 5'-triphosphate group (PPP-RNA), thereby acting as a sensor of viral single-stranded RNAs and inhibiting expression of viral messenger RNAs. Single-stranded PPP-RNAs, which lack 2'-O-methylation of the 5' cap and...
Application: WB
Reactivity: Human
528.00€ *
Review
Anti-IFIT3 (Interferon-induced Protein with Tetratricopeptide Repeats 3, IFIT-3, CIG49, ISG-60, Inte
Anti-IFIT3 (Interferon-induced Protein with...

Item number: 128250.100

IFN-induced antiviral protein which acts as an inhibitor of cellular as well as viral processes, cell migration, proliferation, signaling, and viral replication. Enhances MAVS-mediated host antiviral responses by serving as an adapter bridging TBK1 to MAVS which leads to the activation of TBK1 and phosphorylation of...
Application: WB
Reactivity: Human
564.00€ *
Review
Anti-IFITM1 (CD225, IFI17, Interferon-induced Transmembrane Protein 1, Dispanin Subfamily A Member 2
Anti-IFITM1 (CD225, IFI17, Interferon-induced...

Item number: 128253.100

IFN-induced antiviral protein that mediate cellular innate immunity to at least three major human pathogens, namely influenza A H1N1 virus, West Nile virus, and dengue virus by inhibiting the early step(s) of replication. Plays a key role in the antiproliferative action of IFN-gamma either by inhibiting the ERK...
Application: WB
Reactivity: Human
564.00€ *
Review
33378 from 36884 pages
Viewed