Zu "Q96I45" wurden 11 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-TMEM141
Artikelnummer: E-AB-19100.120
The function of this protein remains unknown.
| Schlagworte: | Anti-TMEM141, Anti-Transmembrane protein 141, TMEM141 Polyclonal Antibody |
| Anwendung: | WB, IHC, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 71,00 €
Anti-TMEM141
Artikelnummer: E-AB-53017.120
The function of this protein remains unknown.
| Schlagworte: | Anti-TMEM141, Anti-Transmembrane protein 141, TMEM141 Polyclonal Antibody |
| Anwendung: | WB, IHC, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 71,00 €
Anti-TMEM141
Artikelnummer: G-PACO30478.50
TMEM141 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, WB, IHC applications. TMEM141 Antibody is a high quality polyclonal antibody for research use only.
| Schlagworte: | Anti-TMEM141, Anti-Transmembrane protein 141 |
| Anwendung: | ELISA, WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
363,00 €
Anti-TMEM141
Artikelnummer: ATA-HPA050244.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 90% and to rat: 93%
| Schlagworte: | Anti-TMEM141, Anti-Transmembrane protein 141 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 335,00 €
Anti-TMEM141
Artikelnummer: ATA-HPA014615.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 69% and to rat: 69%
| Schlagworte: | Anti-TMEM141, Anti-Transmembrane protein 141 |
| Anwendung: | ICC, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 335,00 €
Anti-TM141
Artikelnummer: ELK-ES12674.100
Recommended dilutions: IHC-p 1:50-200. Cellular localization: Membrane , Multi-pass membrane protein .
| Schlagworte: | Anti-TMEM141, Anti-Transmembrane protein 141, TM141 rabbit pAb |
| Anwendung: | IHC, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 169,00 €
TMEM141, Human transmembrane protein 141, Real Time PCR...
Artikelnummer: VHPS-9352
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | TMEM141, Transmembrane protein 141 |
| Anwendung: | RNA quantification |
43,00 €
TMEM141, Recombinant, Human, aa1-108, GST-Tag...
Artikelnummer: 375597.100
Source:, Recombinant protein corresponding to aa1-108 from human TMEM141, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.9kD, AA Sequence: MVNLGLSRVDDAVAAKHPGLGEYAACQSHAFMKGVFTFVTGTGMAFGLQMFIQRKFPYPLQWSLLVAVVAGSVVSYGVTRVESEKCNNLWLFLETGQLPKDRSTDQRS, Storage and Stability: May be stored...
| Schlagworte: | TMEM141, Transmembrane protein 141 |
| MW: | 38,9 |
ab 511,00 €
Anti-TMEM141
Artikelnummer: G-PACO12796.50
TMEM141 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse, Rat and for use in ELISA, WB applications. TMEM141 Antibody is a high quality polyclonal antibody for research use only.
| Schlagworte: | Anti-TMEM141, Anti-Transmembrane protein 141 |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
491,00 €
TMEM141 PrEST Antigen
Artikelnummer: ATA-APrEST72925.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | TMEM141, Transmembrane protein 141 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
247,00 €
TMEM141 PrEST Antigen
Artikelnummer: ATA-APrEST91237.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | TMEM141, Transmembrane protein 141 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
247,00 €