Zu "P0A7L8" wurden 2 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
RpmA, Recombinant, E. coli, aa2-85, GST-Tag (50S Ribosomal Protein L27)
RpmA, Recombinant, E. coli, aa2-85, GST-Tag (50S...

Artikelnummer: 375116.100

Source:, Recombinant protein corresponding to aa2-85 from E. coli 50S Ribosomal Protein L27, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.0kD, AA Sequence: AHKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKFHAGANVGCGRDHTLFAKADGKVKFEVKGPKNRKFISIEAE, Storage and Stability: May be stored at 4°C...
Schlagworte: rpmA, b3185, 50S ribosomal protein L27, Large ribosomal subunit protein bL27
MW: 36
ab 636,00 €
Bewerten
RpmA, Recombinant, E. coli, aa2-85, His-Tag (50S Ribosomal Protein L27)
RpmA, Recombinant, E. coli, aa2-85, His-Tag (50S...

Artikelnummer: 375117.100

Source:, Recombinant protein corresponding to aa2-85 from E. coli 50S Ribosomal Protein L27, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~13kD, AA Sequence: AHKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKFHAGANVGCGRDHTLFAKADGKVKFEVKGPKNRKFISIEAE, Storage and Stability: May be stored at 4°C...
Schlagworte: rpmA, b3185, 50S ribosomal protein L27, Large ribosomal subunit protein bL27
MW: 13
ab 636,00 €
Bewerten