Zu "K09188" wurden 9 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
MLL3 Complex Chemiluminescent Assay Kit
MLL3 Complex Chemiluminescent Assay Kit

Artikelnummer: BPS-79758

The MLL3 Complex Chemiluminescent Assay Kit is designed to measure MLL3 activity for screening and profiling applications, using purified MLL3 and its complex components: WDR5, RbBP5, Ash2, and DPY30. The key to the MLL3 Complex Chemiluminescent Assay Kit is a highly specific antibody that recognizes methylated K4...
Schlagworte: KMT2C, HALR, MLL3, lysine methyltransferase 2C, KLEFS2,
Anwendung: Enzyme kinetics, HTS
Spezies-Reaktivität: human
1.182,00 €
Bewerten
Anti-KMT2C
Anti-KMT2C

Artikelnummer: ATA-HPA074736.100

Protein function: Histone methyltransferase that methylates 'Lys-4' of histone H3 (PubMed:22266653). H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Central component of the MLL2/3 complex, a coactivator complex of nuclear receptors, involved in transcriptional...
Schlagworte: Anti-HALR, Anti-KMT2C, Anti-Homologous to ALR protein, Anti-Lysine N-methyltransferase 2C, Anti-Histone-lysine...
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 369,00 €
Bewerten
Anti-KMT2C
Anti-KMT2C

Artikelnummer: ATA-HPA062814.100

Polyclonal Antibody against Human KMT2C, Gene description: lysine methyltransferase 2C, Alternative Gene Names: HALR, KIAA1506, MLL3, Validated applications: ICC, WB, Uniprot ID: Q8NEZ4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Histone...
Schlagworte: Anti-HALR, Anti-KMT2C, Anti-Homologous to ALR protein, Anti-Lysine N-methyltransferase 2C, Anti-Histone-lysine...
Anwendung: WB, ICC
Wirt: Rabbit
Spezies-Reaktivität: human
491,00 €
Bewerten
Anti-MLL3 / KMT2C, clone 1686CT202.60.69
Anti-MLL3 / KMT2C, clone 1686CT202.60.69

Artikelnummer: NSJ-F55128-0.05ML

In 1X PBS, pH 7.4, with 0.09% sodium azide. KMT2C (Lysine N-methyltransferase 2C), also called MML3 (Myeloid/lymphoid or mixed-lineage leukemia protein 3) is a histone methyltransferase, which means it adds methyl groups to histone proteins. This modification plays a critical role in controlling how genes are turned...
Schlagworte: Anti-HALR, Anti-KMT2C, Anti-Homologous to ALR protein, Anti-Lysine N-methyltransferase 2C, Anti-Histone-lysine...
Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: human
ab 361,00 €
Bewerten
KMT2C (human), recombinant protein
KMT2C (human), recombinant protein

Artikelnummer: ABS-PP-914-L.100

Protein function: Histone methyltransferase that methylates 'Lys-4' of histone H3 (PubMed:22266653). H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Central component of the MLL2/3 complex, a coactivator complex of nuclear receptors, involved in transcriptional...
Schlagworte: Histone-lysine N-methyltransferase 2C, Lysine N-methyltransferase 2C, Homologous to ALR protein, Myeloid/lymphoid or...
Exprimiert in: E.coli
Ursprungsart: human
MW: 31 kD
ab 115,00 €
Bewerten
KMT2C PrEST Antigen
KMT2C PrEST Antigen

Artikelnummer: ATA-APrEST93244.100

Protein function: Histone methyltransferase that methylates 'Lys-4' of histone H3 (PubMed:22266653). H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Central component of the MLL2/3 complex, a coactivator complex of nuclear receptors, involved in transcriptional...
Schlagworte: HALR, KMT2C, Homologous to ALR protein, Lysine N-methyltransferase 2C, Histone-lysine N-methyltransferase 2C,...
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
KMT2C (human), recombinant protein
KMT2C (human), recombinant protein

Artikelnummer: ABS-PP-914.100

Protein function: Histone methyltransferase that methylates 'Lys-4' of histone H3 (PubMed:22266653). H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Central component of the MLL2/3 complex, a coactivator complex of nuclear receptors, involved in transcriptional...
Schlagworte: Histone-lysine N-methyltransferase 2C, Lysine N-methyltransferase 2C, Homologous to ALR protein, Myeloid/lymphoid or...
Exprimiert in: E.coli
Ursprungsart: human
MW: 31 kD
ab 90,00 €
Bewerten
KMT2C PrEST Antigen
KMT2C PrEST Antigen

Artikelnummer: ATA-APrEST95694.100

PrEST Antigen KMT2C, Gene description: lysine methyltransferase 2C, Alternative Gene Names: HALR, KIAA1506, MLL3, Antigen sequence: DTQLKEEYICMYCKHLGAEMDRLQPGEEVEIAELTTDYNNEMEVEGPEDQMVFSEQAANKDVNGQESTPGIVPDAVQVHTEEQQKSHPSESL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
Schlagworte: HALR, KMT2C, Homologous to ALR protein, Lysine N-methyltransferase 2C, Histone-lysine N-methyltransferase 2C,...
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
Anti-trr
Anti-trr

Artikelnummer: CSB-PA818221XA01DLU.100

Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
Schlagworte: Anti-trr, Anti-KMT2C, Anti-CG3848, Anti-Trithorax-related protein, Anti-Lysine N-methyltransferase 2C, Anti-Histone-lysine...
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: Drosophila melanogaster (Fruit fly)
ab 1.529,00 €
Bewerten