- Suchergebnis für K09188
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "K09188" wurden 9 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: BPS-79758
The MLL3 Complex Chemiluminescent Assay Kit is designed to measure MLL3 activity for screening and profiling applications, using purified MLL3 and its complex components: WDR5, RbBP5, Ash2, and DPY30. The key to the MLL3 Complex Chemiluminescent Assay Kit is a highly specific antibody that recognizes methylated K4...
| Schlagworte: | KMT2C, HALR, MLL3, lysine methyltransferase 2C, KLEFS2, |
| Anwendung: | Enzyme kinetics, HTS |
| Spezies-Reaktivität: | human |
1.182,00 €
Artikelnummer: ATA-HPA074736.100
Protein function: Histone methyltransferase that methylates 'Lys-4' of histone H3 (PubMed:22266653). H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Central component of the MLL2/3 complex, a coactivator complex of nuclear receptors, involved in transcriptional...
| Schlagworte: | Anti-HALR, Anti-KMT2C, Anti-Homologous to ALR protein, Anti-Lysine N-methyltransferase 2C, Anti-Histone-lysine... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Artikelnummer: ATA-HPA062814.100
Polyclonal Antibody against Human KMT2C, Gene description: lysine methyltransferase 2C, Alternative Gene Names: HALR, KIAA1506, MLL3, Validated applications: ICC, WB, Uniprot ID: Q8NEZ4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Histone...
| Schlagworte: | Anti-HALR, Anti-KMT2C, Anti-Homologous to ALR protein, Anti-Lysine N-methyltransferase 2C, Anti-Histone-lysine... |
| Anwendung: | WB, ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: NSJ-F55128-0.05ML
In 1X PBS, pH 7.4, with 0.09% sodium azide. KMT2C (Lysine N-methyltransferase 2C), also called MML3 (Myeloid/lymphoid or mixed-lineage leukemia protein 3) is a histone methyltransferase, which means it adds methyl groups to histone proteins. This modification plays a critical role in controlling how genes are turned...
| Schlagworte: | Anti-HALR, Anti-KMT2C, Anti-Homologous to ALR protein, Anti-Lysine N-methyltransferase 2C, Anti-Histone-lysine... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 361,00 €
Artikelnummer: ABS-PP-914-L.100
Protein function: Histone methyltransferase that methylates 'Lys-4' of histone H3 (PubMed:22266653). H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Central component of the MLL2/3 complex, a coactivator complex of nuclear receptors, involved in transcriptional...
| Schlagworte: | Histone-lysine N-methyltransferase 2C, Lysine N-methyltransferase 2C, Homologous to ALR protein, Myeloid/lymphoid or... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 31 kD |
ab 115,00 €
Artikelnummer: ATA-APrEST93244.100
Protein function: Histone methyltransferase that methylates 'Lys-4' of histone H3 (PubMed:22266653). H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Central component of the MLL2/3 complex, a coactivator complex of nuclear receptors, involved in transcriptional...
| Schlagworte: | HALR, KMT2C, Homologous to ALR protein, Lysine N-methyltransferase 2C, Histone-lysine N-methyltransferase 2C,... |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ABS-PP-914.100
Protein function: Histone methyltransferase that methylates 'Lys-4' of histone H3 (PubMed:22266653). H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Central component of the MLL2/3 complex, a coactivator complex of nuclear receptors, involved in transcriptional...
| Schlagworte: | Histone-lysine N-methyltransferase 2C, Lysine N-methyltransferase 2C, Homologous to ALR protein, Myeloid/lymphoid or... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 31 kD |
ab 90,00 €
Artikelnummer: ATA-APrEST95694.100
PrEST Antigen KMT2C, Gene description: lysine methyltransferase 2C, Alternative Gene Names: HALR, KIAA1506, MLL3, Antigen sequence: DTQLKEEYICMYCKHLGAEMDRLQPGEEVEIAELTTDYNNEMEVEGPEDQMVFSEQAANKDVNGQESTPGIVPDAVQVHTEEQQKSHPSESL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
| Schlagworte: | HALR, KMT2C, Homologous to ALR protein, Lysine N-methyltransferase 2C, Histone-lysine N-methyltransferase 2C,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: CSB-PA818221XA01DLU.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-trr, Anti-KMT2C, Anti-CG3848, Anti-Trithorax-related protein, Anti-Lysine N-methyltransferase 2C, Anti-Histone-lysine... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Drosophila melanogaster (Fruit fly) |
ab 1.529,00 €