- Suchergebnis für K02990
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "K02990" wurden 8 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: E-AB-62512.120
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...
Schlagworte: | Anti-S6mt, Anti-MRPS6, Anti-MRP-S6, Anti-C21orf101, Anti-28S ribosomal protein S6, mitochondrial, Anti-Mitochondrial small... |
Anwendung: | WB, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
ab 198,00 €
Artikelnummer: G-CAB9884.100
Anwendung: | IHC, WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
ab 352,00 €
Artikelnummer: ATA-HPA007861.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 83% and to rat: 85%
Schlagworte: | Anti-S6mt, Anti-MRPS6, Anti-MRP-S6, Anti-C21orf101, Anti-28S ribosomal protein S6, mitochondrial, Anti-Mitochondrial small... |
Anwendung: | IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 335,00 €
Artikelnummer: ARG44343.100
Schlagworte: | Anti-S6mt, Anti-S6mt, Anti-MRPS6, Anti-MRP-S6, Anti-MRP-S6, Anti-C21orf101, Anti-28S ribosomal protein S6, mitochondrial,... |
Anwendung: | WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
624,00 €
Artikelnummer: ATA-APrEST71531.100
Buffer: PBS and 1M Urea, pH 7.4.
Schlagworte: | S6mt, MRPS6, MRP-S6, C21orf101, 28S ribosomal protein S6, mitochondrial, Mitochondrial small ribosomal subunit protein bS6m |
Anwendung: | Control antigen |
Exprimiert in: | E.coli |
Ursprungsart: | human |
247,00 €
Artikelnummer: 375149.100
Binds together with S18 to 16S ribosomal RNA. Source: Recombinant protein corresponding to aa1-131 from E. coli rpsF, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.2kD, AA Sequence:...
Schlagworte: | rpsF, b4200 |
MW: | 42,2 |
ab 636,00 €
Artikelnummer: 374277.100
Source:, Recombinant protein corresponding to aa1-125 from human MRPS6, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.1kD, AA Sequence: PRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNRGGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK, Storage and Stability:...
Schlagworte: | S6mt, MRPS6, MRP-S6, C21orf101, 28S ribosomal protein S6, mitochondrial, Mitochondrial small ribosomal subunit protein bS6m |
MW: | 41,1 |
ab 575,00 €
Artikelnummer: G-CAB9884.20
MRPS6 Polyclonal Antibody (CAB9884) from Antibody Genie, is tested in WB, IHC applications.The MRPS6 Polyclonal Antibody (CAB9884) is reactive versus Human, Mouse, Rat samples.
Schlagworte: | Anti-S6mt, Anti-MRPS6, Anti-MRP-S6, Anti-C21orf101, Anti-28S ribosomal protein S6, mitochondrial, Anti-Mitochondrial small... |
Anwendung: | WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
149,00 €