Zu "K02990" wurden 8 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-MRPS6
Artikelnummer: E-AB-62512.120
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...
| Schlagworte: | Anti-S6mt, Anti-MRPS6, Anti-MRP-S6, Anti-C21orf101, Anti-28S ribosomal protein S6, mitochondrial, Anti-Mitochondrial small... |
| Anwendung: | WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 198,00 €
Anti-MRPS6
Artikelnummer: G-CAB9884.100
| Anwendung: | IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 352,00 €
Anti-MRPS6
Artikelnummer: ATA-HPA007861.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 83% and to rat: 85%
| Schlagworte: | Anti-S6mt, Anti-MRPS6, Anti-MRP-S6, Anti-C21orf101, Anti-28S ribosomal protein S6, mitochondrial, Anti-Mitochondrial small... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 335,00 €
Anti-MRPS6
Artikelnummer: ARG44343.100
| Schlagworte: | Anti-S6mt, Anti-S6mt, Anti-MRPS6, Anti-MRP-S6, Anti-MRP-S6, Anti-C21orf101, Anti-28S ribosomal protein S6, mitochondrial,... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
624,00 €
MRPS6 PrEST Antigen
Artikelnummer: ATA-APrEST71531.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | S6mt, MRPS6, MRP-S6, C21orf101, 28S ribosomal protein S6, mitochondrial, Mitochondrial small ribosomal subunit protein bS6m |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
247,00 €
RpsF, Recombinant, E. coli, aa1-131, GST-Tag (30S...
Artikelnummer: 375149.100
Binds together with S18 to 16S ribosomal RNA. Source: Recombinant protein corresponding to aa1-131 from E. coli rpsF, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.2kD, AA Sequence:...
| Schlagworte: | rpsF, b4200 |
| MW: | 42,2 |
ab 636,00 €
MRPS6, Recombinant, Human, aa1-125, GST-Tag (28S...
Artikelnummer: 374277.100
Source:, Recombinant protein corresponding to aa1-125 from human MRPS6, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.1kD, AA Sequence: PRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNRGGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK, Storage and Stability:...
| Schlagworte: | S6mt, MRPS6, MRP-S6, C21orf101, 28S ribosomal protein S6, mitochondrial, Mitochondrial small ribosomal subunit protein bS6m |
| MW: | 41,1 |
ab 575,00 €
Anti-MRPS6
Artikelnummer: G-CAB9884.20
MRPS6 Polyclonal Antibody (CAB9884) from Antibody Genie, is tested in WB, IHC applications.The MRPS6 Polyclonal Antibody (CAB9884) is reactive versus Human, Mouse, Rat samples.
| Schlagworte: | Anti-S6mt, Anti-MRPS6, Anti-MRP-S6, Anti-C21orf101, Anti-28S ribosomal protein S6, mitochondrial, Anti-Mitochondrial small... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
149,00 €