- Suchergebnis für K02970
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "K02970" wurden 5 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: G-PACO01106.50
MRPS21 Antibody from Assay Genie with reactivity against Human, Mouse, Rat, Monkey and for use in ELISA, WB, IHC, IF applications. MRPS21 Antibody is Polyclonal and is a IgG isotype antibody from Assay Genie.
Schlagworte: | Anti-S21mt, Anti-MRPS21, Anti-MDS016, Anti-RPMS21, Anti-MRP-S21, Anti-28S ribosomal protein S21, mitochondrial,... |
Anwendung: | ELISA, WB, IHC, IF |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat, monkey |
320,00 €
-10 %
Rabattaktion
Artikelnummer: ELK-ES2847.100
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...
Schlagworte: | Anti-S21mt, Anti-MRPS21, Anti-MDS016, Anti-RPMS21, Anti-MRP-S21, Anti-Small ribosomal subunit protein bS21m, Anti-28S... |
Anwendung: | WB, IHC, IF, ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat, monkey |
169,00 €
ab 152,10 €
Artikelnummer: G-PACO10605.50
MRPS21 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse, Rat and for use in ELISA, IHC applications. MRPS21 Antibody is a high quality polyclonal antibody for research use only.
Schlagworte: | Anti-S21mt, Anti-MRPS21, Anti-MDS016, Anti-RPMS21, Anti-MRP-S21, Anti-28S ribosomal protein S21, mitochondrial,... |
Anwendung: | ELISA, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
491,00 €
Artikelnummer: 375158.100
Source:, Recombinant protein corresponding to aa2-71 from E. coli RpsU, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.4kD, AA Sequence: PVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVKRHAKKLARENARRTRLY, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to...
Schlagworte: | rpsU, b3065, 30S ribosomal protein S21, Small ribosomal subunit protein bS21 |
MW: | 35,4 |
ab 636,00 €
Artikelnummer: ABD-8C16653.50
Custom conjugation services for this antibody as available (eg. labeling of Anti-MRPS21 with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE, PE/Cy5,...
Schlagworte: | Anti-S21mt, Anti-MDS016, Anti-RPMS21, Anti-MRPS21, Anti-MRP-S21, Anti-28S ribosomal protein S21, mitochondrial,... |
Anwendung: | WB, IHC, IF, ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse |
601,00 €