Zu "K02899" wurden 5 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-MRPL27
Artikelnummer: ATA-HPA021416.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 89% and to rat: 89%
| Schlagworte: | Anti-L27mt, Anti-MRPL27, Anti-MRP-L27, Anti-HSPC250, Anti-39S ribosomal protein L27, mitochondrial, Anti-Mitochondrial... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 335,00 €
Anti-RM27
Artikelnummer: ELK-ES9808.100
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...
| Schlagworte: | Anti-L27mt, Anti-MRPL27, Anti-MRP-L27, Anti-HSPC250, Anti-Large ribosomal subunit protein bL27m, Anti-39S ribosomal... |
| Anwendung: | WB, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 169,00 €
MRPL27 PrEST Antigen
Artikelnummer: ATA-APrEST75566.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | L27mt, MRPL27, MRP-L27, HSPC250, 39S ribosomal protein L27, mitochondrial, Mitochondrial large ribosomal subunit protein... |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
247,00 €
RpmA, Recombinant, E. coli, aa2-85, GST-Tag (50S...
Artikelnummer: 375116.100
Source:, Recombinant protein corresponding to aa2-85 from E. coli 50S Ribosomal Protein L27, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.0kD, AA Sequence: AHKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKFHAGANVGCGRDHTLFAKADGKVKFEVKGPKNRKFISIEAE, Storage and Stability: May be stored at 4°C...
| Schlagworte: | rpmA, b3185, 50S ribosomal protein L27, Large ribosomal subunit protein bL27 |
| MW: | 36 |
ab 636,00 €
RpmA, Recombinant, E. coli, aa2-85, His-Tag (50S...
Artikelnummer: 375117.100
Source:, Recombinant protein corresponding to aa2-85 from E. coli 50S Ribosomal Protein L27, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~13kD, AA Sequence: AHKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKFHAGANVGCGRDHTLFAKADGKVKFEVKGPKNRKFISIEAE, Storage and Stability: May be stored at 4°C...
| Schlagworte: | rpmA, b3185, 50S ribosomal protein L27, Large ribosomal subunit protein bL27 |
| MW: | 13 |
ab 636,00 €
