Zu "GeneID 20208" wurden 6 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
NEU
SAA (Serum Amyloid A) BioAssay(TM) ELISA Kit (Mouse)
SAA (Serum Amyloid A) BioAssay(TM) ELISA Kit (Mouse)

Artikelnummer: 384316.96

Sample Type:, Serum, Plasma, Biological Fluids, Intended Use: This BioAssay(TM) kit is a sandwich ELISA for in vitro quantitative measurement of SAA in Mouse serum, plasma and other biological fluids, Sensitivity: 0.938ng/mL, Range: 1.563-100ng/mL, Specificity: Mouse, Test Principle: This BioAssay(TM) ELISA kit uses...
Schlagworte: Saa1, Serum amyloid A-1 protein
Anwendung: ELISA
Reaktivität: Mouse
714,00 €
Bewerten
NEU
Serum Amyloid A (SAA) BioAssay(TM) ELISA Kit (Mouse)
Serum Amyloid A (SAA) BioAssay(TM) ELISA Kit (Mouse)

Artikelnummer: 517642.96

Specificity:, This assay has high sensitivity and excellent specificity for detection of Serum Amyloid A (SAA). No significant cross-reactivity or interference between Serum Amyloid A (SAA) and analogues was observed. Precision: Intra-Assay: CV<10% , Inter-Assay: CV<12%, Kit Components: 96-well strip plate, 1x Plate...
Schlagworte: Saa1, Serum amyloid A-1 protein
Anwendung: ELISA
Reaktivität: Mouse
860,00 €
Bewerten
-20 %
Angebot
Mouse serum Amyloid A ELISA Kit
Mouse serum Amyloid A ELISA Kit

Artikelnummer: ARG81841.96

Protein function: Major acute phase protein. [The UniProt Consortium]
Schlagworte: Saa1, Serum amyloid A-1 protein
Anwendung: ELISA
Reaktivität: Mouse
732,00 € 585,60 €
Bewerten
+ Gratis T-Shirt
Mouse SAA ELISA Kit
Mouse SAA ELISA Kit

Artikelnummer: KOA0689

Natural and recombinant mouse SAA. There is no detectable cross-reactivity with other relevant proteins. Serum amyloid A protein(SAA), also known as SAA1, is a protein that in humans is encoded by the SAA1 gene. This gene encodes a member of the serum amyloid A family of apolipoproteins. It is mapped to 11p15.1. SAA...
Schlagworte: Saa1, Serum amyloid A-1 protein
Anwendung: ELISA
Reaktivität: Mouse
613,00 €
Bewerten
Mouse SAA (Serum amyloid A) CLIA Kit
Mouse SAA (Serum amyloid A) CLIA Kit

Artikelnummer: E-CL-M0607.96

Type: Sandwich. Detection Range: 0.31~20ng/mL. Sensitivity: 0.19ng/mL. Tested Sample Types: Serum, Plasma, Cell supernatant. Test principle: This CLIA kit uses the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Mouse SAA . Standards or samples are...
Schlagworte: Saa1, Serum amyloid A-1 protein
Anwendung: CLIA
Reaktivität: Mouse
658,00 €
Bewerten
Saa1, Recombinant, Mouse, aa20-122, His-SUMO-Tag (Serum Amyloid A-1 Protein)
Saa1, Recombinant, Mouse, aa20-122, His-SUMO-Tag (Serum...

Artikelnummer: 375189.10

Major acute phase protein. Source: Recombinant protein corresponding to aa20-122 from mouse Saa1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~27.8kD, AA Sequence: GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY, Storage and...
Schlagworte: Saa1, Serum amyloid A-1 protein
MW: 27,8
ab 406,00 €
Bewerten