Zu "GeneID 20208" wurden 8 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Mouse SAA (Serum Amyloid A) ELISA Kit
Artikelnummer: ELK-ELK1625.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse SAA. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse SAA. Next,...
| Schlagworte: | Saa1, Serum amyloid A-1 protein |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
ab 365,00 €
Mouse SAA (Serum amyloid A) CLIA Kit
Artikelnummer: E-CL-M0607.96
Type: Sandwich. Detection Range: 0.31~20ng/mL. Sensitivity: 0.19ng/mL. Tested Sample Types: Serum, Plasma, Cell supernatant. Test principle: This CLIA kit uses the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Mouse SAA . Standards or samples are...
| Schlagworte: | Saa1, Serum amyloid A-1 protein |
| Anwendung: | CLIA |
| Spezies-Reaktivität: | mouse |
541,00 €
Mouse serum Amyloid A ELISA Kit
Artikelnummer: ARG81841.96
Protein function: Major acute phase protein. [The UniProt Consortium]
| Schlagworte: | Saa1, Serum amyloid A-1 protein |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
1.048,00 €
Mouse SAA (Serum amyloid A) CLIA Kit
Artikelnummer: E-CL-M0607.24
Type: Sandwich. Detection Range: 0.31~20ng/mL. Sensitivity: 0.19ng/mL. Tested Sample Types: Serum, Plasma, Cell supernatant. Test principle: This CLIA kit uses the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Mouse SAA . Standards or samples are...
| Schlagworte: | Saa1, Serum amyloid A-1 protein |
| Anwendung: | CLIA |
| Spezies-Reaktivität: | mouse |
ab 142,00 €
Mouse SAA ELISA Kit
Artikelnummer: KOA0689
Natural and recombinant mouse SAA. There is no detectable cross-reactivity with other relevant proteins. Serum amyloid A protein(SAA), also known as SAA1, is a protein that in humans is encoded by the SAA1 gene. This gene encodes a member of the serum amyloid A family of apolipoproteins. It is mapped to 11p15.1. SAA...
| Schlagworte: | Saa1, Serum amyloid A-1 protein |
| Anwendung: | ELISA |
| Wirt: | Mouse |
| Spezies-Reaktivität: | mouse |
848,00 €
SAA (Serum Amyloid A) BioAssay(TM) ELISA Kit (Mouse)
Artikelnummer: 384316.96
Sample Type:, Serum, Plasma, Biological Fluids, Intended Use: This BioAssay(TM) kit is a sandwich ELISA for in vitro quantitative measurement of SAA in Mouse serum, plasma and other biological fluids, Sensitivity: 0.938ng/mL, Range: 1.563-100ng/mL, Specificity: Mouse, Test Principle: This BioAssay(TM) ELISA kit uses...
| Schlagworte: | Saa1, Serum amyloid A-1 protein |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
909,00 €
Serum Amyloid A (SAA) BioAssay(TM) ELISA Kit (Mouse)
Artikelnummer: 517642.96
Specificity:, This assay has high sensitivity and excellent specificity for detection of Serum Amyloid A (SAA). No significant cross-reactivity or interference between Serum Amyloid A (SAA) and analogues was observed. Precision: Intra-Assay: CV<10% , Inter-Assay: CV<12%, Kit Components: 96-well strip plate, 1x Plate...
| Schlagworte: | Saa1, Serum amyloid A-1 protein |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
939,00 €
Saa1, Recombinant, Mouse, aa20-122, His-SUMO-Tag (Serum...
Artikelnummer: 375189.100
Major acute phase protein. Source: Recombinant protein corresponding to aa20-122 from mouse Saa1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~27.8kD, AA Sequence: GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY, Storage and...
| Schlagworte: | Saa1, Serum amyloid A-1 protein |
| MW: | 27,8 |
ab 575,00 €