Zu "GeneID 13214" wurden 4 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Mouse BD-1 / beta Defensin 1 ELISA Kit
Mouse BD-1 / beta Defensin 1 ELISA Kit

Artikelnummer: G-MOFI00227.96

Anwendung: ELISA
Reaktivität: Mouse
629,00 €
Beta Defensin-1, mouse recombinant (rHuBD-1)
Beta Defensin-1, mouse recombinant (rHuBD-1)

Artikelnummer: 97410.1

Mouse recombinant BD 1 produced in E.coli is a single, non-glycosylated, polypeptide chain containing 37 amino acids and having a molecular mass of 4.1 kDa. The Defensin family are highly similar in their protein sequence and are microbicidal and cytotoxic peptides made by neutrophils. Beta Defensin-1 is an...
Schlagworte: Beta-defensin 1, BD-1, Defensin beta 1, hBD-1, HBD1, HBP1, DEFB1, HBD-1, HBP-1, DEFB101, DEFB-1, MGC51822.
Anwendung: Cell Culture
Reaktivität: Mouse
MW: 4100 D
Bitte fragen Sie den aktuellen Preis für diesen Artikel an.
Defensin Beta 1 (DEFb1) BioAssay(TM) ELISA Kit (Mouse)
Defensin Beta 1 (DEFb1) BioAssay(TM) ELISA Kit (Mouse)

Artikelnummer: 024598.96

Defensin Beta 1 (DEFb1) BioAssay(TM) ELISA Kit (Mouse) is a sandwich enzyme immunoassay for in vitro quantitative measurement of DEFb1 in mouse serum, plasma and other biological fluids. Detection Range: 0.78-50ng/ml, Sensitivity: 0.28ng/ml, Storage and Stability: Desiccation recommended. The Standard, Detection...
Schlagworte: BD-1, Defb1, mBD-1, Beta-defensin 1, Defensin, beta 1
Anwendung: ELISA
Reaktivität: Mouse
833,00 €
Beta-defensin 1, Recombinant, Mouse, aa33-69, His-SUMO-Tag (Defb1)
Beta-defensin 1, Recombinant, Mouse, aa33-69,...

Artikelnummer: 372437.10

Has bactericidal activity. Source: Recombinant protein corresponding to aa33-69 from mouse Defb1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~20.1kD, AA Sequence: DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid...
Schlagworte: BD-1, mBD-1, Defb1, Beta-defensin 1, Defensin, beta 1
MW: 20,1
ab 449,00 €