BNP, Human (Natriuretic Peptides B, Gamma-brain Natriuretic Peptide, NPPB)

BNP, Human (Natriuretic Peptides B, Gamma-brain Natriuretic Peptide, NPPB)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
B2702-30A.1 1 mg - -

1 - 19 Werktage

552,00 €
 
Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions... mehr
Produktinformationen "BNP, Human (Natriuretic Peptides B, Gamma-brain Natriuretic Peptide, NPPB)"
Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. It helps to restore the body's salt and H2O balance and improves heart function. B-type Natriuretic Peptide Human is a polypeptide chain containing 32aa and having a molecular mass of 3464D. AA Sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OH, Molecular Weight: ~3.464kD, Storage and Stability: Lyophilized powder may be stored at -20°C. Reconstitute with ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Hersteller: United States Biological
Hersteller-Nr: B2702-30A

Eigenschaften

Konjugat: No
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "BNP, Human (Natriuretic Peptides B, Gamma-brain Natriuretic Peptide, NPPB)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Hier folgen Informationen zur Produktreferenz. mehr
Zuletzt angesehen