Sigirr, Recombinant, Mouse, aa1-117, His-Tag (Single Ig IL-1-related Receptor)

Sigirr, Recombinant, Mouse, aa1-117, His-Tag (Single Ig IL-1-related Receptor)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375297.20 20 µg - -

3 - 19 Werktage*

497,00 €
375297.100 100 µg - -

3 - 19 Werktage*

827,00 €
 
Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Attenuates... mehr
Produktinformationen "Sigirr, Recombinant, Mouse, aa1-117, His-Tag (Single Ig IL-1-related Receptor)"
Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through an TIR-TIR domain interaction with TLR4. Through its Extracellular domain interferes with the heterodimerization of Il1R1 and IL1RAP (By similarity). Source: Recombinant protein corresponding to aa1-117 from mouse Sigirr, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~14.7kD, AA Sequence: MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: TIR8, Tir8, Sigirr, Toll/interleukin-1 receptor 8, Single Ig IL-1-related receptor, Single Ig IL-1R-related molecule, Single immunoglobulin domain-containing IL1R-related protein
Hersteller: United States Biological
Hersteller-Nr: 375297

Eigenschaften

Konjugat: No
MW: 14,7
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Sigirr, Recombinant, Mouse, aa1-117, His-Tag (Single Ig IL-1-related Receptor)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen