Retn, Recombinant, Mouse, aa21-114, His-Tag (Resistin)

Retn, Recombinant, Mouse, aa21-114, His-Tag (Resistin)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375045.20 20 µg - -

3 - 19 Werktage*

455,00 €
375045.100 100 µg - -

3 - 19 Werktage*

713,00 €
 
Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells.... mehr
Produktinformationen "Retn, Recombinant, Mouse, aa21-114, His-Tag (Resistin)"
Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes. Source: Recombinant protein corresponding to aa21-114 from mouse Retn, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~14.2kD, AA Sequence: SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Retn, ADSF, Fizz3, Resistin, Cysteine-rich secreted protein FIZZ3, Adipose tissue-specific secretory factor, Adipose-specific cysteine-rich secreted protein A12-alpha
Hersteller: United States Biological
Hersteller-Nr: 375045

Eigenschaften

Konjugat: No
MW: 14,2
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Retn, Recombinant, Mouse, aa21-114, His-Tag (Resistin)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen