PRL, Recombinant, Porcine, aa31-229, His-SUMO-Tag (Prolactin)

PRL, Recombinant, Porcine, aa31-229, His-SUMO-Tag (Prolactin)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374854.20 20 µg - -

3 - 19 Werktage*

636,00 €
374854.100 100 µg - -

3 - 19 Werktage*

985,00 €
 
Prolactin acts primarily on the mammary gland by promoting lactation.||Source:|Recombinant... mehr
Produktinformationen "PRL, Recombinant, Porcine, aa31-229, His-SUMO-Tag (Prolactin)"
Prolactin acts primarily on the mammary gland by promoting lactation. Source: Recombinant protein corresponding to aa31-229 from porcine PRL, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39kD, AA Sequence: LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGIKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: PRL, Prolactin
Hersteller: United States Biological
Hersteller-Nr: 374854

Eigenschaften

Konjugat: No
Wirt: E.coli
Spezies-Reaktivität: swine
MW: 39 kD
Reinheit: ~90% (SDS-PAGE)

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "PRL, Recombinant, Porcine, aa31-229, His-SUMO-Tag (Prolactin)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen