Oxytocin-neurophysin 1, Recombinant, Human, aa32-125, His-tag (OXT)

Oxytocin-neurophysin 1, Recombinant, Human, aa32-125, His-tag (OXT)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
406013.20 20 µg - -

3 - 19 Werktage*

497,00 €
406013.100 100 µg - -

3 - 19 Werktage*

827,00 €
 
Neurophysin 1 specifically binds oxytocin.Oxytocin causes contraction of the smooth muscle of the... mehr
Produktinformationen "Oxytocin-neurophysin 1, Recombinant, Human, aa32-125, His-tag (OXT)"
Neurophysin 1 specifically binds oxytocin.Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Source: Recombinant protein corresponding to aa32-125 from Human Oxytocin-neurophysin 1, fused to His-tag at N-terminal, expressed in Yeast. Molecular Weight: ~11.6kD, AA Sequence: AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: OT, OXT
Hersteller: United States Biological
Hersteller-Nr: 406013

Eigenschaften

Konjugat: No
Ursprungsart: Human
MW: 11.6 kD
Reinheit: ~90% (SDS-PAGE)

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Oxytocin-neurophysin 1, Recombinant, Human, aa32-125, His-tag (OXT)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen