Oxytocin-neurophysin 1, Recombinant, Human, aa32-125, His-tag (OXT)

Neurophysin 1 specifically binds oxytocin.Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Source: Recombinant protein corresponding to aa32-125 from Human Oxytocin-neurophysin 1, fused to His-tag at N-terminal, expressed in Yeast. Molecular Weight: ~11.6kD, AA Sequence: AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.