Oxytocin-neurophysin 1, Recombinant, Human, aa32-125, His-tag, Myc-tag (OxT)

Oxytocin-neurophysin 1, Recombinant, Human, aa32-125, His-tag, Myc-tag (OxT)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
406014.20 20 µg - -

3 - 19 Werktage*

420,00 €
406014.100 100 µg - -

3 - 19 Werktage*

679,00 €
Neurophysin 1 specifically binds oxytocin.Oxytocin causes contraction of the smooth muscle of the... mehr
Produktinformationen "Oxytocin-neurophysin 1, Recombinant, Human, aa32-125, His-tag, Myc-tag (OxT)"
Neurophysin 1 specifically binds oxytocin.Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Source: Recombinant protein corresponding to aa32-125 from human Oxytocin-neurophysin 1, fused to His-tag at N-terminal and fused to Myc-tag at C-terminal, expressed in E. coli. Molecular Weight: ~14.6kD, AA Sequence: AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: OT, OXT
Hersteller: United States Biological
Hersteller-Nr: 406014


Konjugat: No
Exprimiert in: E.coli
Ursprungsart: Human
MW: 14.6 kD
Reinheit: ~85% (SDS-PAGE)

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Oxytocin-neurophysin 1, Recombinant, Human, aa32-125, His-tag, Myc-tag (OxT)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen