Interleukin-8, Recombinant, Chicken, aa17-102 (CXCL8)

Interleukin-8, Recombinant, Chicken, aa17-102 (CXCL8)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
405967.20 20 µg - -

3 - 19 Werktage*

626,00 €
405967.100 100 µg - -

3 - 19 Werktage*

932,00 €
 
May be an autocrine factor that promotes the growth of fibroblasts and is involved in the... mehr
Produktinformationen "Interleukin-8, Recombinant, Chicken, aa17-102 (CXCL8)"
May be an autocrine factor that promotes the growth of fibroblasts and is involved in the neoplastic transformation of fibroblasts by v-Src. Chemotactic for peripheral blood mononuclear cells as well as for heterophils. Source: Recombinant protein corresponding to aa17-102 from chicken Interleukin-8 expressed in E. coli. Molecular Weight: ~9.4kD, AA Sequence: ALSQGRTLVKMGNELRCQCISTHSKFIHPKSIQDVKLTPSGPHCKNVEIIATLKDGREVCLDPTAPWVQLIVKALMAKAQLNSDAP, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: 9E3, CEF4, IL-8, CEF-4, EMF-1, CXCL8, Interleukin-8, C-X-C motif chemokine 8, Embryo fibroblast protein 1, Chemokine (C-X-C motif) ligand 8
Hersteller: United States Biological
Hersteller-Nr: 405967

Eigenschaften

Konjugat: No
MW: 9,4
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Interleukin-8, Recombinant, Chicken, aa17-102 (CXCL8)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen