IL1B, Recombinant, Human, aa117-269, GST-Tag (Interleukin-1 beta)

IL1B, Recombinant, Human, aa117-269, GST-Tag (Interleukin-1 beta)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
373803.10 10 µg - -

3 - 19 Werktage*

354,00 €
373803.50 50 µg - -

3 - 19 Werktage*

472,00 €
373803.100 100 µg - -

3 - 19 Werktage*

588,00 €
373803.200 200 µg - -

3 - 19 Werktage*

767,00 €
 
Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2... mehr
Produktinformationen "IL1B, Recombinant, Human, aa117-269, GST-Tag (Interleukin-1 beta)"
Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. Recombinant protein corresponding to aa117-269 from human Interleukin-1 beta, fused to GST-Tag at N-terminal, expressed in E. coli. , Molecular Weight: , ~44.4kD, Amino Acid Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Schlagworte: IL1F2, IL-1 beta, Catabolin, Interleukin-1 beta
Hersteller: United States Biological
Hersteller-Nr: 373803

Eigenschaften

Konjugat: No
MW: 44,4
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "IL1B, Recombinant, Human, aa117-269, GST-Tag (Interleukin-1 beta)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen