IIL1B, Recombinant, Human, aa117-269, His-SUMO-Tag (Interleukin-1 beta)

IIL1B, Recombinant, Human, aa117-269, His-SUMO-Tag (Interleukin-1 beta)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
373778.10 10 µg - -

3 - 19 Werktage*

354,00 €
373778.50 50 µg - -

3 - 19 Werktage*

472,00 €
373778.100 100 µg - -

3 - 19 Werktage*

658,00 €
373778.200 200 µg - -

3 - 19 Werktage*

906,00 €
 
Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2... mehr
Produktinformationen "IIL1B, Recombinant, Human, aa117-269, His-SUMO-Tag (Interleukin-1 beta)"
Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. Source: Recombinant protein corresponding to aa117-269 from human Interleukin-1 beta, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33.4kD, AA Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: IL1F2, IL-1 beta, Catabolin, Interleukin-1 beta
Hersteller: United States Biological
Hersteller-Nr: 373778

Eigenschaften

Konjugat: No
MW: 33,4
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "IIL1B, Recombinant, Human, aa117-269, His-SUMO-Tag (Interleukin-1 beta)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen