FGF10, Recombinant, Human, aa37-208, His-SUMO-Tag (Fibroblast Growth Factor 10)

FGF10, Recombinant, Human, aa37-208, His-SUMO-Tag (Fibroblast Growth Factor 10)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
373314.10 10 µg - -

3 - 19 Werktage*

354,00 €
373314.50 50 µg - -

3 - 19 Werktage*

472,00 €
373314.100 100 µg - -

3 - 19 Werktage*

658,00 €
373314.200 200 µg - -

3 - 19 Werktage*

906,00 €
 
Plays an important role in the regulation of embryonic development, cell proliferation and cell... mehr
Produktinformationen "FGF10, Recombinant, Human, aa37-208, His-SUMO-Tag (Fibroblast Growth Factor 10)"
Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. May play a role in wound healing. Source: Recombinant protein corresponding to aa37-208 from human FGF10, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.4kD, AA Sequence: CQALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: FGF10, FGF-10, Fibroblast growth factor 10, Keratinocyte growth factor 2
Hersteller: United States Biological
Hersteller-Nr: 373314

Eigenschaften

Konjugat: No
MW: 35,4
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "FGF10, Recombinant, Human, aa37-208, His-SUMO-Tag (Fibroblast Growth Factor 10)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen