Cutaneous T-Cell Attracting Chemokine (CTACK) Recombinant, Human

Cutaneous T-Cell Attracting Chemokine (CTACK) Recombinant, Human
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
154231.10 10 µg - -

3 - 19 Werktage*

395,00 €
154231.50 50 µg - -

3 - 19 Werktage*

609,00 €
154231.200 200 µg - -

3 - 19 Werktage*

915,00 €
 
Source:|Recombinant Human from E. coli||Purity:|>95%||Endotoxin:|1.0EU per 1ug (determined by the... mehr
Produktinformationen "Cutaneous T-Cell Attracting Chemokine (CTACK) Recombinant, Human"
Source:, Recombinant Human from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q9Y4X3, Fragment: Phe25~Gly112 (Accession No: Q9Y4X3), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-FLLPPS TACCTQLYRK PLSDKLLRKV IQVELQEADG DCHLQAFVLH LAQRSICIHP QNPSLSQWFE HQERKLHGTL PKLNFGMLRK MG, Epitope Tag: N-terminal Tags: His-tag and S-tag, Molecular Weight: 15.8kD, Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation, SDS-PAGE., Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -80°C. Aliquots are stable for at least 12 months from date of shipment. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.
Hersteller: United States Biological
Hersteller-Nr: 154231

Eigenschaften

Konjugat: No
Format: Highly Purified

Datenbank Information

UniProt ID : Q9Y4X3 | Passende Produkte

Handhabung & Sicherheit

Lagerung: vT
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Cutaneous T-Cell Attracting Chemokine (CTACK) Recombinant, Human"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen