CCL16, Recombinant, Human, aa24-120, His-SUMO-Tag (C-C Motif Chemokine 16)

CCL16, Recombinant, Human, aa24-120, His-SUMO-Tag (C-C Motif Chemokine 16)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
372620.10 10 µg - -

3 - 19 Werktage*

354,00 €
372620.50 50 µg - -

3 - 19 Werktage*

472,00 €
372620.100 100 µg - -

3 - 19 Werktage*

658,00 €
372620.200 200 µg - -

3 - 19 Werktage*

906,00 €
 
Shows chemotactic activity for lymphocytes and monocytes but not neutrophils. Also shows potent... mehr
Produktinformationen "CCL16, Recombinant, Human, aa24-120, His-SUMO-Tag (C-C Motif Chemokine 16)"
Shows chemotactic activity for lymphocytes and monocytes but not neutrophils. Also shows potent myelosuppressive activity, suppresses proliferation of myeloid progenitor cells. Recombinant SCYA16 shows chemotactic activity for monocytes and THP-1 monocytes, but not for resting lymphocytes and neutrophils. Induces a calcium flux in THP-1 cells that were desensitized by prior expression to RANTES. Source: Recombinant protein corresponding to aa24-120 from human C-C Motif Chemokine 16, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.2kD, AA Sequence: QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: LMC, CCL16, MTN-1, HCC-4, NCC-4, LCC-1, ILINCK, Monotactin-1, Chemokine LEC, Chemokine CC-4, C-C motif chemokine 16, Liver-expressed chemokine, IL-10-inducible chemokine, Small-inducible cytokine A16, Lymphocyte and monocyte chemoattractant
Hersteller: United States Biological
Hersteller-Nr: 372620

Eigenschaften

Konjugat: No
MW: 27,2
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "CCL16, Recombinant, Human, aa24-120, His-SUMO-Tag (C-C Motif Chemokine 16)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen