Bone Morphogenetic Protein 3, Recombinant, Mouse, aa359-468, His-Tag (Bmp3)

Negatively regulates bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification. Source: Recombinant protein corresponding to aa359-468 of mouse Bone Morphogenetic Protein 3, fused to 6xHis-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~14.4kD, AA Sequence: QWVEPRNCARRYLKVDFADIGWSEWIISPKSFDAFYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVSGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVDSCACR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.