Bone Morphogenetic Protein 3, Recombinant, Mouse, aa359-468, His-Tag (Bmp3)

Bone Morphogenetic Protein 3, Recombinant, Mouse, aa359-468, His-Tag (Bmp3)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
517828.20 20 µg - -

3 - 19 Werktage*

511,00 €
517828.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Negatively regulates bone density. Antagonizes the ability of certain osteogenic BMPs to induce... mehr
Produktinformationen "Bone Morphogenetic Protein 3, Recombinant, Mouse, aa359-468, His-Tag (Bmp3)"
Negatively regulates bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification. Source: Recombinant protein corresponding to aa359-468 of mouse Bone Morphogenetic Protein 3, fused to 6xHis-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~14.4kD, AA Sequence: QWVEPRNCARRYLKVDFADIGWSEWIISPKSFDAFYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVSGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVDSCACR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Bmp3, BMP-3, Bone morphogenetic protein 3
Hersteller: United States Biological
Hersteller-Nr: 517828

Eigenschaften

Konjugat: No
Exprimiert in: E.coli
Ursprungsart: Mouse
MW: 14.4 kD
Reinheit: ?85% (SDS-PAGE)

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Bone Morphogenetic Protein 3, Recombinant, Mouse, aa359-468, His-Tag (Bmp3)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen