BMP4, Recombinant, Human, aa293-408, His-SUMO-Tag (Bone Morphogenetic Protein 4)

BMP4, Recombinant, Human, aa293-408, His-SUMO-Tag (Bone Morphogenetic Protein 4)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
372463.10 10 µg - -

1 - 19 Werktage

354,00 €
372463.50 50 µg - -

1 - 19 Werktage

472,00 €
372463.100 100 µg - -

1 - 19 Werktage

658,00 €
372463.200 200 µg - -

1 - 19 Werktage

906,00 €
 
Induces cartilage and bone formation. Also act in mesoderm induction, tooth development, limb... mehr
Produktinformationen "BMP4, Recombinant, Human, aa293-408, His-SUMO-Tag (Bone Morphogenetic Protein 4)"
Induces cartilage and bone formation. Also act in mesoderm induction, tooth development, limb formation and fracture repair. Acts in concert with PTHLH/PTHRP to stimulate ductal outgrowth during embryonic mammary development and to inhibit hair follicle induction. Source: Recombinant protein corresponding to aa293-408 from human BMP4, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~29.1kD, AA Sequence: SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: BMP4, BMP2B, BMP-4, BMP-2B, Bone morphogenetic protein 4, Bone morphogenetic protein 2B
Hersteller: United States Biological
Hersteller-Nr: 372463

Eigenschaften

Konjugat: No
MW: 29,1
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "BMP4, Recombinant, Human, aa293-408, His-SUMO-Tag (Bone Morphogenetic Protein 4)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Hier folgen Informationen zur Produktreferenz. mehr
Zuletzt angesehen