Beta-defensin 1, Recombinant, Mouse, aa33-69, His-SUMO-Tag (Defb1)

Beta-defensin 1, Recombinant, Mouse, aa33-69, His-SUMO-Tag (Defb1)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
372437.10 10 µg - -

3 - 19 Werktage*

449,00 €
372437.50 50 µg - -

3 - 19 Werktage*

605,00 €
372437.100 100 µg - -

3 - 19 Werktage*

886,00 €
372437.200 200 µg - -

3 - 19 Werktage*

1.281,00 €
 
Has bactericidal activity.||Source:|Recombinant protein corresponding to aa33-69 from mouse... mehr
Produktinformationen "Beta-defensin 1, Recombinant, Mouse, aa33-69, His-SUMO-Tag (Defb1)"
Has bactericidal activity. Source: Recombinant protein corresponding to aa33-69 from mouse Defb1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~20.1kD, AA Sequence: DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: BD-1, mBD-1, Defb1, Beta-defensin 1, Defensin, beta 1
Hersteller: United States Biological
Hersteller-Nr: 372437

Eigenschaften

Konjugat: No
MW: 20,1
Format: Highly Purified

Datenbank Information

UniProt ID : P56386 | Finde Alternativen
Gene ID GeneID 13214 | Finde Alternativen

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Beta-defensin 1, Recombinant, Mouse, aa33-69, His-SUMO-Tag (Defb1)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen