Zinc Metalloproteinase Adamalysin-2, Recombinant, Crotalus Adamanteus, aa1-203, His-tag

Zinc Metalloproteinase Adamalysin-2, Recombinant, Crotalus Adamanteus, aa1-203, His-tag
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
406068.20 20 µg - -

3 - 19 Werktage*

511,00 €
406068.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Has no significant hemorrhagic activity, but inactivates serpins by limited proteolysis of their... mehr
Produktinformationen "Zinc Metalloproteinase Adamalysin-2, Recombinant, Crotalus Adamanteus, aa1-203, His-tag"
Has no significant hemorrhagic activity, but inactivates serpins by limited proteolysis of their reactive-site loops. Source: Recombinant protein corresponding to aa1-203 from Crotalus Adamanteus zinc metalloproteinase Adamalysin-2, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.1kD, AA Sequence: QQNLPQRYIELVVVADRRVFMKYNSDLNIIRTRVHEIVNIINGFYRSLNIDVSLVNLEIWSGQDPLTIQSSSSNTLNSEGLWREKVLLNKKKKDNAQLLTAIEFKCETLGKAYLNSMCNPRSSVGIVKDHSPINLLVAVTMAHELGHNLGMEHDGKDCLRGASLCIMRPGLTPGRSYEFSDDSMGYYQKFLNQYKPQCILNKP, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: SVMP, EC=3.4.24.46, Proteinase II, Adamalysin II, Snake venom metalloproteinase adamalysin-2
Hersteller: United States Biological
Hersteller-Nr: 406068

Eigenschaften

Konjugat: No
MW: 27,1
Format: Purified

Datenbank Information

UniProt ID : P34179 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Zinc Metalloproteinase Adamalysin-2, Recombinant, Crotalus Adamanteus, aa1-203, His-tag"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen