Zinc Metalloproteinase Adamalysin-2, Recombinant, Crotalus Adamanteus, aa1-203, His-tag

Has no significant hemorrhagic activity, but inactivates serpins by limited proteolysis of their reactive-site loops. Source: Recombinant protein corresponding to aa1-203 from Crotalus Adamanteus zinc metalloproteinase Adamalysin-2, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.1kD, AA Sequence: QQNLPQRYIELVVVADRRVFMKYNSDLNIIRTRVHEIVNIINGFYRSLNIDVSLVNLEIWSGQDPLTIQSSSSNTLNSEGLWREKVLLNKKKKDNAQLLTAIEFKCETLGKAYLNSMCNPRSSVGIVKDHSPINLLVAVTMAHELGHNLGMEHDGKDCLRGASLCIMRPGLTPGRSYEFSDDSMGYYQKFLNQYKPQCILNKP, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.