Vitamin D-binding Protein, Recombinant, Human, aa19-474, His-SUMOSTAR-tag (GC)

Vitamin D-binding Protein, Recombinant, Human, aa19-474, His-SUMOSTAR-tag (GC)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
406064.20 20 µg - -

3 - 19 Werktage*

416,00 €
406064.100 100 µg - -

3 - 19 Werktage*

637,00 €
 
Involved in vitamin D transport and storage, scavenging of extracellular G-actin, enhancement of... mehr
Produktinformationen "Vitamin D-binding Protein, Recombinant, Human, aa19-474, His-SUMOSTAR-tag (GC)"
Involved in vitamin D transport and storage, scavenging of extracellular G-actin, enhancement of the chemotactic activity of C5 alpha for neutrophils in inflammation and macrophage activation. Source: Recombinant protein corresponding to aa19-474 from Human Vitamin D-binding Protein, fused to His-SUMOSTAR-tag at N-terminal, expressed in Yeast. Molecular Weight: ~67.0kD, AA Sequence: RGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDAELKNIL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: GC, Gc, VDB, DBP, GcMAF, Gc-MAF, DBP-maf, Gc-globulin, Group-specific component, Vitamin D-binding protein, Gc protein-derived macrophage activating factor, Vitamin D-binding protein-macrophage activating factor
Hersteller: United States Biological
Hersteller-Nr: 406064

Eigenschaften

Konjugat: No
MW: 67
Format: Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Vitamin D-binding Protein, Recombinant, Human, aa19-474, His-SUMOSTAR-tag (GC)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen