Viral interleukin-10 Homolog, Recombinant, Human Cytomegalovirus, aa26-176 (UL111A)

Viral interleukin-10 Homolog, Recombinant, Human Cytomegalovirus, aa26-176 (UL111A)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
406063.20 20 µg - -

3 - 19 Werktage*

570,00 €
406063.100 100 µg - -

3 - 19 Werktage*

832,00 €
 
Functional viral IL-10 homolog. Can bind to the human IL-10 receptor and compete with human IL-10... mehr
Produktinformationen "Viral interleukin-10 Homolog, Recombinant, Human Cytomegalovirus, aa26-176 (UL111A)"
Functional viral IL-10 homolog. Can bind to the human IL-10 receptor and compete with human IL-10 for binding sites. Requires both subunits of the human IL-10 receptor complex to induce signal transduction events and biological activities. IL-10 signaling pathway has several immunosuppressive activities that are exploited by the virus. Inhibits TLR-induced type I interferon production in host plasmacytoid dendritic cells. Source: Recombinant protein corresponding to aa26-176 from human Cytomegalovirus Viral interleukin-10 Homolog, expressed in E. coli. Molecular Weight: ~17.5kD, AA Sequence: ATTTTIKNTKPQCRPEDYATRLQDLRVTFHRVKPTLQREDDYSVWLDGTVVKGCWGCSVMDWLLRRYLEIVFPAGDHVYPGLKTELHSMRSTLESIYKDMRQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLSELDTLFSRLEEYLHSRK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: vIL-10, UL111A, cmvIL-10, Viral interleukin-10 homolog
Hersteller: United States Biological
Hersteller-Nr: 406063

Eigenschaften

Konjugat: No
MW: 17,5
Format: Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Viral interleukin-10 Homolog, Recombinant, Human Cytomegalovirus, aa26-176 (UL111A)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen