Transcription factor PU.1, Recombinant, Human, aa1-270, His-tag (SPI1)

Transcription factor PU.1, Recombinant, Human, aa1-270, His-tag (SPI1)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
406052.20 20 µg - -

3 - 19 Werktage*

420,00 €
406052.100 100 µg - -

3 - 19 Werktage*

679,00 €
 
Binds to the PU-box, a purine-rich DNA sequence (5'-GAGGAA-3') that can act as a... mehr
Produktinformationen "Transcription factor PU.1, Recombinant, Human, aa1-270, His-tag (SPI1)"
Binds to the PU-box, a purine-rich DNA sequence (5'-GAGGAA-3') that can act as a lymphoid-specific enhancer. This protein is a transcriptional activator that may be specifically involved in the differentiation or activation of macrophages or B-cells. Also binds RNA and may modulate pre-mRNA splicing. Source: Recombinant protein corresponding to aa1-270 from human Transcription factor PU.1, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.1kD, AA Sequence: MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRHPPH, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: SPI1, Transcription factor PU.1, 31 kDa-transforming protein
Hersteller: United States Biological
Hersteller-Nr: 406052

Eigenschaften

Konjugat: No
MW: 35,1
Format: Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Transcription factor PU.1, Recombinant, Human, aa1-270, His-tag (SPI1)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen