Sulfotransferase 1A1, Recombinant, Mouse, aa1-291, His-SUMO-Tag, Myc-Tag (Sult1a1)

Sulfotransferase 1A1, Recombinant, Mouse, aa1-291, His-SUMO-Tag, Myc-Tag (Sult1a1)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
406045.20 20 µg - -

3 - 19 Werktage*

575,00 €
406045.100 100 µg - -

3 - 19 Werktage*

855,00 €
 
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to... mehr
Produktinformationen "Sulfotransferase 1A1, Recombinant, Mouse, aa1-291, His-SUMO-Tag, Myc-Tag (Sult1a1)"
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. Has also estrogen sulfotransferase activity. responsible for the sulfonation and activation of minoxidil. Is Mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk. Source: Recombinant protein corresponding to aa1-291 from mouse Sulfotransferase 1A1, fused to His-SUMO-Tag at N-terminal and fused to Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~54kD, AA Sequence: MEPLRKPLVPVKGIPLIKYFAETMEQLQNFTAWPDDVLISTYPKSGTNWMSEIMDMIYQGGKLDKCGRAPVYARIPFLEFSCPGVPPGLETLKETPAPRIIKTHLPLSLLPQSLLDQKIKVIYVARNAKDVVVSYYNFYKMAKLHPDPGTWESFLENFMDGKVSYGSWYQHVKEWWELRRTHPVLYLFYEDMKENPKREIKKILEFLGRSLPEETVDLIVHHTSFKKMKENPMANYTTIPTEVMDHTIYPFMRKGTIGDWKNTFTVAQSEHFDAHYAKLMTGCDFTFRCQI, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: St1a1, ST1A1, ST1A4, mSTp1, Sult1a1, EC=2.8.2.1, Sulfokinase, Sulfotransferase 1A1, Aryl sulfotransferase, Phenol sulfotransferase, Phenol/aryl sulfotransferase
Hersteller: United States Biological
Hersteller-Nr: 406045

Eigenschaften

Konjugat: No
MW: 54
Format: Purified

Datenbank Information

UniProt ID : P52840 | Passende Produkte

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Sulfotransferase 1A1, Recombinant, Mouse, aa1-291, His-SUMO-Tag, Myc-Tag (Sult1a1)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen