Signal Peptidase I, Recombinant, Mycobacterium Tuberculosis, aa88-294, His-SUMO-Tag (LepB)

Signal Peptidase I, Recombinant, Mycobacterium Tuberculosis, aa88-294, His-SUMO-Tag (LepB)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375298.20 20 µg - -

3 - 19 Werktage*

511,00 €
375298.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Source:|Recombinant protein corresponding to aa88-294 from mycobacterium tuberculosis lepB, fused... mehr
Produktinformationen "Signal Peptidase I, Recombinant, Mycobacterium Tuberculosis, aa88-294, His-SUMO-Tag (LepB)"
Source:, Recombinant protein corresponding to aa88-294 from mycobacterium tuberculosis lepB, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~38.6kD, AA Sequence: RPYLIPSESMEPTLHGCSTCVGDRIMVDKLSYRFGSPQPGDVIVFRGPPSWNVGYKSIRSHNVAVRWVQNALSFIGFVPPDENDLVKRVIAVGGQTVQCRSDTGLTVNGRPLKEPYLDPATMMADPSIYPCLGSEFGPVTVPPGRVWVMGDNRTHSADSRAHCPLLCTDDPLPGTVPVANVIGKARLIVWPPSRWGVVRSVNPQQGR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: lepB, Rv2903c, SPase I, MTCY274.34c, EC=3.4.21.89, Signal peptidase I, Leader peptidase I
Hersteller: United States Biological
Hersteller-Nr: 375298

Eigenschaften

Konjugat: No
MW: 38,6
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Signal Peptidase I, Recombinant, Mycobacterium Tuberculosis, aa88-294, His-SUMO-Tag (LepB)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen