Sialic Acid-binding Lectin, Recombinant, Rana Japonica, aa1-111, His-Tag

Sialic Acid-binding Lectin, Recombinant, Rana Japonica, aa1-111, His-Tag
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375295.20 20 µg - -

3 - 19 Werktage*

511,00 €
375295.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
The S-lectins in frog eggs may be involved in the fertilization and development of the frog... mehr
Produktinformationen "Sialic Acid-binding Lectin, Recombinant, Rana Japonica, aa1-111, His-Tag"
The S-lectins in frog eggs may be involved in the fertilization and development of the frog embryo. This lectin preferentially agglutinate a large variety of tumor cells, but it does not agglutinate non-transformed cells and erythrocytes. Source: Recombinant protein corresponding to aa1-111 from rana japonica Sialic acid-binding lectin, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~16.3kD, AA Sequence: QNWAKFQEKHIPNTSNINCNTIMDKSIYIVGGQCKERNTFIISSATTVKAICSGASTNRNVLSTTRFQLNTCIRSATAPRPCPYNSRTETNVICVKCENRLPVHFAGIGRC, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: EC=3.1.27.-, Sialic acid-binding lectin
Hersteller: United States Biological
Hersteller-Nr: 375295

Eigenschaften

Konjugat: No
MW: 16,3
Format: Highly Purified

Datenbank Information

UniProt ID : P18839 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Sialic Acid-binding Lectin, Recombinant, Rana Japonica, aa1-111, His-Tag"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen