SH-1, Recombinant, Zea mays (Maize), aa555-802, His-SUMO-Tag (Sucrose Synthase 1)

SH-1, Recombinant, Zea mays (Maize), aa555-802, His-SUMO-Tag (Sucrose Synthase 1)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375291.20 20 µg - -

3 - 19 Werktage*

511,00 €
375291.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Sucrose-cleaving enzyme that provides UDP-glucose and fructose for various metabolic pathways.... mehr
Produktinformationen "SH-1, Recombinant, Zea mays (Maize), aa555-802, His-SUMO-Tag (Sucrose Synthase 1)"
Sucrose-cleaving enzyme that provides UDP-glucose and fructose for various metabolic pathways. Most active in the sink tissues where it is responsible for the breakdown of the arriving sucrose. Source: Recombinant protein corresponding to aa555-802 from zea mays (Maize) SH-1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~44.8kD, AA Sequence: NSEHKFVLKDKKKPIIFSMARLDRVKNMTGLVEMYGKNARLRELANLVIVAGDHGKESKDREEQAEFKKMYSLIDEYKLKGHIRWISAQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVIESMTCGLPTIATCHGGPAEIIVDGVSGLHIDPYHSDKAADILVNFFDKCKADPSYWDEISQGGLQRIYEKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRRYIEMFYALKYRSLASQVPLSFD, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: SH-1, Shrunken-1, EC=2.4.1.13, Sucrose synthase 1, Sucrose-UDP glucosyltransferase 1
Hersteller: United States Biological
Hersteller-Nr: 375291

Eigenschaften

Konjugat: No
MW: 44,8
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "SH-1, Recombinant, Zea mays (Maize), aa555-802, His-SUMO-Tag (Sucrose Synthase 1)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen