SFTPD, Recombinant, Human, aa21-375, His-Tag (Pulmonary Surfactant-associated Protein D)

SFTPD, Recombinant, Human, aa21-375, His-Tag (Pulmonary Surfactant-associated Protein D)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375290.20 20 µg - -

3 - 19 Werktage*

497,00 €
375290.100 100 µg - -

3 - 19 Werktage*

777,00 €
 
Contributes to the lung's defense against inhaled microorganisms, organic antigens and toxins.... mehr
Produktinformationen "SFTPD, Recombinant, Human, aa21-375, His-Tag (Pulmonary Surfactant-associated Protein D)"
Contributes to the lung's defense against inhaled microorganisms, organic antigens and toxins. Interacts with compounds such as bacterial lipopolysaccharides, oligosaccharides and fatty acids and modulates leukocyte action in immune response. May participate in the Extracellular domain reorganization or turnover of pulmonary surfactant. Binds strongly maltose residues and to a lesser extent other alpha-glucosyl moieties. Source: Recombinant protein corresponding to aa21-375 from human SFTPD, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~35.2kD, AA Sequence: AEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIF, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: SP-D, PSP-D, SFTPD, COLEC7, Collectin-7, Lung surfactant protein D, Pulmonary surfactant-associated protein D
Hersteller: United States Biological
Hersteller-Nr: 375290

Eigenschaften

Konjugat: No
MW: 35,2
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "SFTPD, Recombinant, Human, aa21-375, His-Tag (Pulmonary Surfactant-associated Protein D)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen