Serpina3n, Recombinant, Mouse, aa21-418, His-Tag (Serine Protease Inhibitor A3N)

Serpina3n, Recombinant, Mouse, aa21-418, His-Tag (Serine Protease Inhibitor A3N)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375265.20 20 µg - -

3 - 19 Werktage*

455,00 €
375265.100 100 µg - -

3 - 19 Werktage*

711,00 €
 
The single human alpha1-antichymotrypsin gene (SERPINA3) is represented by a cluster of 14... mehr
Produktinformationen "Serpina3n, Recombinant, Mouse, aa21-418, His-Tag (Serine Protease Inhibitor A3N)"
The single human alpha1-antichymotrypsin gene (SERPINA3) is represented by a cluster of 14 individual murine paralogs. Source: Recombinant protein corresponding to aa21-418 from mouse Serpina3n, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~46.8kD, AA Sequence: FPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFILPDQGRMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFSISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Spi2, Serpina3n, Serpin A3N, Serine protease inhibitor A3N
Hersteller: United States Biological
Hersteller-Nr: 375265

Eigenschaften

Konjugat: No
Ursprungsart: Mouse
MW: 46.8 kD
Reinheit: ~90% (SDS-PAGE)

Datenbank Information

UniProt ID : Q91WP6 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Serpina3n, Recombinant, Mouse, aa21-418, His-Tag (Serine Protease Inhibitor A3N)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen