Serine Protease 29, Recombinant, Mouse, aa18-179, His-B2M-Tag (Prss29)

Serine Protease 29, Recombinant, Mouse, aa18-179, His-B2M-Tag (Prss29)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375257.20 20 µg - -

3 - 19 Werktage*

455,00 €
375257.100 100 µg - -

3 - 19 Werktage*

713,00 €
 
Involved in embryo hatching and implantation.||Source:|Recombinant protein corresponding to... mehr
Produktinformationen "Serine Protease 29, Recombinant, Mouse, aa18-179, His-B2M-Tag (Prss29)"
Involved in embryo hatching and implantation. Source: Recombinant protein corresponding to aa18-179 from mouse Prss29, fused to His-B2M-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~31.9kD, AA Sequence: GTPAPGPEDVLMGIVGGHSAPQGKWPWQVSLRIYRYYWAFWVHNCGGSIIHPQWVLTAAHCIRERDADPSVFRIRVGEAYLYGGKELLSVSRVIIHPDFVHAGLGSDVALLQLAVSVQSFPNVKPVKLPSESLEVTKKDVCWVTGWGAVSTHRSLPPPYRLQ, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Isp2, ISP-2, Prss29, Strypsin-2, EC=3.4.21.-, Serine protease 29, Strypsin-related protein, Tryptase-like proteinase, Implantation serine proteinase 2
Hersteller: United States Biological
Hersteller-Nr: 375257

Eigenschaften

Konjugat: No
Exprimiert in: E.coli
Ursprungsart: Mouse
MW: 31.9 kD
Reinheit: ?90% (SDS-PAGE)

Datenbank Information

UniProt ID : Q99MS4 | Passende Produkte
Gene ID : GeneID 114662 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Serine Protease 29, Recombinant, Mouse, aa18-179, His-B2M-Tag (Prss29)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen