Serine Protease 29, Recombinant, Mouse, aa18-179, His-B2M-Tag (Prss29)

Involved in embryo hatching and implantation. Source: Recombinant protein corresponding to aa18-179 from mouse Prss29, fused to His-B2M-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~31.9kD, AA Sequence: GTPAPGPEDVLMGIVGGHSAPQGKWPWQVSLRIYRYYWAFWVHNCGGSIIHPQWVLTAAHCIRERDADPSVFRIRVGEAYLYGGKELLSVSRVIIHPDFVHAGLGSDVALLQLAVSVQSFPNVKPVKLPSESLEVTKKDVCWVTGWGAVSTHRSLPPPYRLQ, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.