SEPP1, Recombinant, Human, aa20-381, His-Tag (Selenoprotein P)

SEPP1, Recombinant, Human, aa20-381, His-Tag (Selenoprotein P)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375251.20 20 µg - -

3 - 19 Werktage*

416,00 €
375251.100 100 µg - -

3 - 19 Werktage*

637,00 €
 
Might be responsible for some of the Extracellular domain antioxidant defense properties of... mehr
Produktinformationen "SEPP1, Recombinant, Human, aa20-381, His-Tag (Selenoprotein P)"
Might be responsible for some of the Extracellular domain antioxidant defense properties of selenium or might be involved in the transport of selenium. May supply selenium to tissues such as brain and testis. Source: Recombinant protein corresponding to aa20-381 from human Selenoprotein P, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~42.6kD, AA Sequence: ESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASSYLCILQASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRSSCCHCRHLIFEKTGSAITSQCKENLPSLCSSQGLRAEENITESCQSRLPPAASQISQQLIPTEASASSRSKNQAKKSESPSN, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: SeP, Selenoprotein P
Hersteller: United States Biological
Hersteller-Nr: 375251

Eigenschaften

Konjugat: No
MW: 42,6
Format: Highly Purified

Datenbank Information

UniProt ID : P49908 | Passende Produkte
Gene ID : GeneID 6414 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "SEPP1, Recombinant, Human, aa20-381, His-Tag (Selenoprotein P)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen