Selt, Recombinant, Mouse, aa20-195, His-Tag (Selenoprotein T)

Selt, Recombinant, Mouse, aa20-195, His-Tag (Selenoprotein T)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375243.20 20 µg - -

3 - 19 Werktage*

575,00 €
375243.100 100 µg - -

3 - 19 Werktage*

855,00 €
 
Source:|Recombinant protein corresponding to aa20-195 from mouse Selenoprotein T, fused to... mehr
Produktinformationen "Selt, Recombinant, Mouse, aa20-195, His-Tag (Selenoprotein T)"
Source:, Recombinant protein corresponding to aa20-195 from mouse Selenoprotein T, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~24.2kD, AA Sequence: SANLGGVPSKRLKMQYATGPLLKFQICVSUGYRRVFEEYMRVISQRYPDIRIEGENYLPQPIYRHIASFLSVFKLVLIGLIIVGKDPFAFFGMQAPSIWQWGQENKVYACMMVFFLSNMIENQCMSTGAFEITLNDVPVWSKLESGHLPSMQQLVQILDNEMKLNVHMDSIPHHRS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: SelT, Thioredoxin reductase-like selenoprotein T
Hersteller: United States Biological
Hersteller-Nr: 375243

Eigenschaften

Konjugat: No
MW: 24,2
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Selt, Recombinant, Mouse, aa20-195, His-Tag (Selenoprotein T)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen