Selenoprotein M, Recombinant, Human, aa24-145 (SELM)

May function as a thiol-disulfide oxidoreductase that participates in disulfide bond formation. Source: Recombinant protein corresponding to aa24-145 from human Selenoprotein M, expressed in E. coli. Molecular Weight: ~13.9kD, AA Sequence: ATAYRPDWNRLSGLTRARVETCGGSQLNRLKEVKAFVTQDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKPPEETSDHADL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.