Selenoprotein M, Recombinant, Human, aa24-145 (SELM)

Selenoprotein M, Recombinant, Human, aa24-145 (SELM)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
406037.20 20 µg - -

3 - 19 Werktage*

535,00 €
406037.100 100 µg - -

3 - 19 Werktage*

794,00 €
 
May function as a thiol-disulfide oxidoreductase that participates in disulfide bond... mehr
Produktinformationen "Selenoprotein M, Recombinant, Human, aa24-145 (SELM)"
May function as a thiol-disulfide oxidoreductase that participates in disulfide bond formation. Source: Recombinant protein corresponding to aa24-145 from human Selenoprotein M, expressed in E. coli. Molecular Weight: ~13.9kD, AA Sequence: ATAYRPDWNRLSGLTRARVETCGGSQLNRLKEVKAFVTQDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKPPEETSDHADL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: SelM, Selenoprotein M
Hersteller: United States Biological
Hersteller-Nr: 406037

Eigenschaften

Konjugat: No
MW: 13,9
Format: Purified

Datenbank Information

UniProt ID : Q8WWX9 | Passende Produkte
Gene ID : GeneID 140606 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Selenoprotein M, Recombinant, Human, aa24-145 (SELM)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen