SELE, Recombinant, Rabbit, aa24-495, His-Tag (E-selectin)

SELE, Recombinant, Rabbit, aa24-495, His-Tag (E-selectin)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375242.10 10 µg - -

3 - 19 Werktage*

475,00 €
375242.50 50 µg - -

3 - 19 Werktage*

643,00 €
375242.100 100 µg - -

3 - 19 Werktage*

953,00 €
375242.200 200 µg - -

3 - 19 Werktage*

1.392,00 €
 
Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood... mehr
Produktinformationen "SELE, Recombinant, Rabbit, aa24-495, His-Tag (E-selectin)"
Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with PSGL1/SELPLG. May have a role in capillary morphogenesis. Source: Recombinant protein corresponding to aa24-495 from rabbit SELE, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~53.6kD, AA Sequence: WTYHFSAENMTYDEASAYCQQNYTHLVAIQNKEEIDYLNSILDYSPSYYWIGIRKVNNVWIWVGTHKPLTEGAKNWAPGEPNNKQNNEDCVEIYIKRPKDTGMWNDERCSKKKLALCYTAACTEASCSGHGECIETINNYSCKCYPGFSGLKCEQVVTCEAQVQPQHGSLNCTHPLGNFSYNSSCSVSCERGYLPSSTETTWCTSSGEWSAPPATCKVVECDTMGKPANGDVKCSPSQGSAPWNTTCTFDCEEGFTLLGARSLQCTSSGSWDNEKPTCKAVSCDTIHHPQNGSVSCSNSSEGKFTFRSSCNFTCEENFLLRGPAQVECTAQGQWTQQAPVCEAVKCDPVHTLEDGFVKCTHPHTGEFTYKSSCTFNCREGFELHGSAQLECTSQGQWAQELPSCQVVQCPSLAVLGKTNVSCSGEPVFGTVCNFACPEGWTLNGSAALMCGAEGQWSGMLPTCEEPIASNVP, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: SELE, CD62E, ELAM-1, LECAM2, E-selectin, CD62 antigen-like family member E, Endothelial leukocyte adhesion molecule 1, Leukocyte-endothelial cell adhesion molecule 2
Hersteller: United States Biological
Hersteller-Nr: 375242

Eigenschaften

Konjugat: No
MW: 53,6
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "SELE, Recombinant, Rabbit, aa24-495, His-Tag (E-selectin)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen