SDF2L1, Recombinant, Mouse, aa29-211, His-Tag (Stromal Cell-derived Factor 2-like Protein 1)

SDF2L1, Recombinant, Mouse, aa29-211, His-Tag (Stromal Cell-derived Factor 2-like Protein 1)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375235.20 20 µg - -

3 - 19 Werktage*

455,00 €
375235.100 100 µg - -

3 - 19 Werktage*

711,00 €
 
Source:|Recombinant protein corresponding to aa29-211 from mouse SDF2L1, fused to His-Tag at... mehr
Produktinformationen "SDF2L1, Recombinant, Mouse, aa29-211, His-Tag (Stromal Cell-derived Factor 2-like Protein 1)"
Source:, Recombinant protein corresponding to aa29-211 from mouse SDF2L1, fused to His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Yeast. Molecular Weight: ~24.4kD, AA Sequence: SKASAGLVTCGSVLKLLNTHHKVRLHSHDIKYGSGSGQQSVTGVEESDDANSYWRIRGGSEGGCPRGLPVRCGQAVRLTHVLTGKNLHTHHFPSPLSNNQEVSAFGEDGEGDDLDLWTVRCSGQHWEREASVRFQHVGTSVFLSVTGEQYGNPIRGQHEVHGMPSANAHNTWKAMEGIFIKPGADLSTGHDEL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Sdf2l1, SDF2-like protein 1, Stromal cell-derived factor 2-like protein 1
Hersteller: United States Biological
Hersteller-Nr: 375235

Eigenschaften

Konjugat: No
MW: 24,4
Format: Highly Purified

Datenbank Information

UniProt ID : Q9ESP1 | Passende Produkte
Gene ID : GeneID 64136 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "SDF2L1, Recombinant, Mouse, aa29-211, His-Tag (Stromal Cell-derived Factor 2-like Protein 1)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen