Scn, Recombinant, Staphylococcus Aureus, aa32-116, His-SUMO-Tag (Staphylococcal Complement Inhibitor

Scn, Recombinant, Staphylococcus Aureus, aa32-116, His-SUMO-Tag (Staphylococcal Complement Inhibitor
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375222.20 20 µg - -

3 - 19 Werktage*

511,00 €
375222.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Involved in countering the first line of host defense mechanisms. Efficiently inhibits... mehr
Produktinformationen "Scn, Recombinant, Staphylococcus Aureus, aa32-116, His-SUMO-Tag (Staphylococcal Complement Inhibitor"
Involved in countering the first line of host defense mechanisms. Efficiently inhibits opsonization, phagocytosis and killing of S.aureus by human neutrophils. Acts by binding and stabilizing human C3 convertases (C4b2a and C3bBb), leading to their inactivation. The convertases are no longer able to cleave complement C3, therefore preventing further C3b deposition on the bacterial surface and phagocytosis of the bacterium. Also prevents C5a-induced neutrophil responses (By similarity). Source: Recombinant protein corresponding to aa32-116 from staphylococcus aureus Scn, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~25.8kD, AA Sequence: STSLPTSNEYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKISGLKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: scn, SCIN, SA1754, Staphylococcal complement inhibitor
Hersteller: United States Biological
Hersteller-Nr: 375222

Eigenschaften

Konjugat: No
MW: 25,8
Format: Highly Purified

Datenbank Information

KEGG ID : K14199 | Passende Produkte
UniProt ID : Q99SU9 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Scn, Recombinant, Staphylococcus Aureus, aa32-116, His-SUMO-Tag (Staphylococcal Complement Inhibitor"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen