Scgb3a2, Recombinant, Mouse, aa22-139, His-GST-Tag (Secretoglobin Family 3A Member 2)

Scgb3a2, Recombinant, Mouse, aa22-139, His-GST-Tag (Secretoglobin Family 3A Member 2)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375219.20 20 µg - -

3 - 19 Werktage*

455,00 €
375219.100 100 µg - -

3 - 19 Werktage*

713,00 €
Enzyme and pathway databases.||Source:|Recombinant protein corresponding to aa22-139 from mouse... mehr
Produktinformationen "Scgb3a2, Recombinant, Mouse, aa22-139, His-GST-Tag (Secretoglobin Family 3A Member 2)"
Enzyme and pathway databases. Source: Recombinant protein corresponding to aa22-139 from mouse Scgb3a2, fused to His-GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~43.2kD, AA Sequence: LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Pnsp1, PnSP-1, Scgb3a2, Pneumo secretory protein 1, Uteroglobin-related protein 1, Secretoglobin family 3A member 2
Hersteller: United States Biological
Hersteller-Nr: 375219


Konjugat: No
MW: 43,2
Format: Purified

Datenbank Information

UniProt ID : Q920H1 | Passende Produkte
Gene ID : GeneID 117158 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Scgb3a2, Recombinant, Mouse, aa22-139, His-GST-Tag (Secretoglobin Family 3A Member 2)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen