SARAF, Recombinant, Human, aa195-339, His-Tag (Store-operated Calcium Entry-associated Regulatory Fa

SARAF, Recombinant, Human, aa195-339, His-Tag (Store-operated Calcium Entry-associated Regulatory Fa
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375206.20 20 µg - -

3 - 19 Werktage*

416,00 €
375206.100 100 µg - -

3 - 19 Werktage*

637,00 €
 
Negative regulator of store-operated Ca2+ entry (SOCE) involved in protecting cells from Ca2+... mehr
Produktinformationen "SARAF, Recombinant, Human, aa195-339, His-Tag (Store-operated Calcium Entry-associated Regulatory Fa"
Negative regulator of store-operated Ca2+ entry (SOCE) involved in protecting cells from Ca2+ overfilling. In response to cytosolic Ca2+ elevation after endoplasmic reticulum Ca2+ refilling, promotes a slow inactivation of STIM (STIM1 or STIM2)-dependent SOCE activity: possibly act by facilitating the deoligomerization of STIM to efficiently turn off ORAI when the endoplasmic reticulum lumen is filled with the appropriate Ca2+ levels, and thus preventing the overload of the cell with excessive Ca2+ ions. Source: Recombinant protein corresponding to aa195-339 from human SARAF, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.5kD, AA Sequence: SDGQYSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGLGTGGILGYLFGSNRAATPFSDSWYYPSYPPSYPGTWNRAYSPLHGGSGSYSVCSNSDTKTRTASGYGGTRRR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: SARAF, TMEM66, HSPC035, Protein FOAP-7, Transmembrane protein 66, HBV XAg-transactivated protein 3, SOCE-associated regulatory factor, HBV X-transactivated gene 3 protein, Store-operated calcium entry-associated regulatory factor
Hersteller: United States Biological
Hersteller-Nr: 375206

Eigenschaften

Konjugat: No
MW: 17,5
Format: Highly Purified

Datenbank Information

UniProt ID : Q96BY9 | Passende Produkte
Gene ID : GeneID 51669 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "SARAF, Recombinant, Human, aa195-339, His-Tag (Store-operated Calcium Entry-associated Regulatory Fa"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen