SAP130, Recombinant, Mouse, aa845-1057, His-Tag (Histone Deacetylase Complex Subunit Sap130)

SAP130, Recombinant, Mouse, aa845-1057, His-Tag (Histone Deacetylase Complex Subunit Sap130)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375201.20 20 µg - -

3 - 19 Werktage*

497,00 €
375201.100 100 µg - -

3 - 19 Werktage*

827,00 €
 
Acts as a transcriptional repressor. May function in the assembly and/or enzymatic activity of... mehr
Produktinformationen "SAP130, Recombinant, Mouse, aa845-1057, His-Tag (Histone Deacetylase Complex Subunit Sap130)"
Acts as a transcriptional repressor. May function in the assembly and/or enzymatic activity of the mSin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes. Source: Recombinant protein corresponding to aa845-1057 from mouse Sap130, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~26.8kD, AA Sequence: PRKQQHVISTEEGDMMETNSTDDEKSAAKSLLVKAEKRKSPPKEYIDEEGVRYVPVRPRPPITLLRHYRNPWKAAYHHFQRYSDVRVKEEKKAMLQEIANQKGVSCRAQGWKVHLCAAQLLQLTNLEHDVYERLTNLQEGIIPKKKAATDDDLHRINELIQGNMQRCKLVMDQISEARDSMLKVLDHKDRVLKLLNKNGTVKKVSKLKRKEKV, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Sap130, Sin3-associated polypeptide p130, 130 kDa Sin3-associated polypeptide, Histone deacetylase complex subunit SAP130
Hersteller: United States Biological
Hersteller-Nr: 375201

Eigenschaften

Konjugat: No
MW: 26,8
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "SAP130, Recombinant, Mouse, aa845-1057, His-Tag (Histone Deacetylase Complex Subunit Sap130)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen