SAP130, Recombinant, Mouse, aa845-1057, His-Tag (Histone Deacetylase Complex Subunit Sap130)

SAP130, Recombinant, Mouse, aa845-1057, His-Tag (Histone Deacetylase Complex Subunit Sap130)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375200.20 20 µg - -

3 - 19 Werktage*

511,00 €
375200.100 100 µg - -

3 - 19 Werktage*

818,00 €
Acts as a transcriptional repressor. May function in the assembly and/or enzymatic activity of... mehr
Produktinformationen "SAP130, Recombinant, Mouse, aa845-1057, His-Tag (Histone Deacetylase Complex Subunit Sap130)"
Acts as a transcriptional repressor. May function in the assembly and/or enzymatic activity of the mSin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes, Source: Recombinant protein corresponding to aa845-1057 from mouse Sap130, fused to His-Tag at N-terminal expressed in E. coli. Molecular Weight: ~28.8kD, AA Sequence: PRKQQHVISTEEGDMMETNSTDDEKSAAKSLLVKAEKRKSPPKEYIDEEGVRYVPVRPRPPITLLRHYRNPWKAAYHHFQRYSDVRVKEEKKAMLQEIANQKGVSCRAQGWKVHLCAAQLLQLTNLEHDVYERLTNLQEGIIPKKKAATDDDLHRINELIQGNMQRCKLVMDQISEARDSMLKVLDHKDRVLKLLNKNGTVKKVSKLKRKEKV, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Sap130, Sin3-associated polypeptide p130, 130 kDa Sin3-associated polypeptide, Histone deacetylase complex subunit SAP130
Hersteller: United States Biological
Hersteller-Nr: 375200


Konjugat: No
MW: 28,8
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "SAP130, Recombinant, Mouse, aa845-1057, His-Tag (Histone Deacetylase Complex Subunit Sap130)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen