SAMHD1, Recombinant, Mouse, aa395-626, His-Tag (SAM Domain and HD Domain-containing Protein 1)

SAMHD1, Recombinant, Mouse, aa395-626, His-Tag (SAM Domain and HD Domain-containing Protein 1)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375198.20 20 µg - -

3 - 19 Werktage*

455,00 €
375198.100 100 µg - -

3 - 19 Werktage*

713,00 €
 
Host restriction nuclease that blocks early-stage virus replication in dendritic and other... mehr
Produktinformationen "SAMHD1, Recombinant, Mouse, aa395-626, His-Tag (SAM Domain and HD Domain-containing Protein 1)"
Host restriction nuclease that blocks early-stage virus replication in dendritic and other myeloid cells. Likewise, suppresses LINE-1 retrotransposon activity. May function by reducing the cellular dNTP levels to levels too low for retroviral reverse transcription to occur. May play a role in mediating proinflammatory responses to TNF-alpha signaling. Source: Recombinant protein corresponding to aa395-626 from mouse SAMHD1, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~30.6kD, AA Sequence: DIMITDAFLKADPYVEITGTAGKKFRISTAIDDMEAFTKLTDNIFLEVLHSTDPQLSEAQSILRNIECRNLYKYLGETQPKREKIRKEEYERLPQEVAKAKPEKAPDVELKAEDFIVDVINVDYGMEDKNPIDRVHFYCKSNSKQAVRINKEQVSQLLPEKFAEQLIRVYCKKKDGKSLDAAGKHFVQWCALRDFTKPQDGDIIAPLITPLKWNNKTSSCLQEVSKVKTCLK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: mSAMHD1, dNTPase, Interferon-gamma-inducible protein Mg11, SAM domain and HD domain-containing protein 1, Deoxynucleoside triphosphate triphosphohydrolase SAMHD1
Hersteller: United States Biological
Hersteller-Nr: 375198

Eigenschaften

Konjugat: No
MW: 30,6
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "SAMHD1, Recombinant, Mouse, aa395-626, His-Tag (SAM Domain and HD Domain-containing Protein 1)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen