Salivary Antigen 1, Recombinant, Ctenocephalides Felis, aa19-176, His-SUMO-Tag

Salivary Antigen 1, Recombinant, Ctenocephalides Felis, aa19-176, His-SUMO-Tag
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375196.20 20 µg - -

3 - 19 Werktage*

511,00 €
375196.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Source:|Recombinant protein corresponding to aa19-176 from ctenocephalides felis Salivary antigen... mehr
Produktinformationen "Salivary Antigen 1, Recombinant, Ctenocephalides Felis, aa19-176, His-SUMO-Tag"
Source:, Recombinant protein corresponding to aa19-176 from ctenocephalides felis Salivary antigen 1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34.1kD, AA Sequence: EDIWKVNKKCTSGGKNQDRKLDQIIQKGQQVKIQNICKLIRDKPHTNQEKEKCMKFCKKVCKGYRGACDGNICYCSRPSNLGPDWKVSKECKDPNNKDSRPTEIVPYRQQLAIPNICKLKNSETNEDSKCKKHCKEKCRGGNDAGCDGNFCYCRPKNK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: FS-I, Cte f 1, Salivary antigen 1
Hersteller: United States Biological
Hersteller-Nr: 375196

Eigenschaften

Konjugat: No
MW: 34,1
Format: Highly Purified

Datenbank Information

UniProt ID : Q94424 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Salivary Antigen 1, Recombinant, Ctenocephalides Felis, aa19-176, His-SUMO-Tag"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen